KEGG   Meleagris gallopavo (turkey): 100550682Help
Entry
100550682         CDS       T01523                                 

Gene name
SETDB2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100550682 (SETDB2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100550682 (SETDB2)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100550682 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100550682 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-HC5HC2H Pre-SET MBD zf-HC5HC2H_2 DUF5314
Motif
Other DBs
NCBI-GeneID: 100550682
NCBI-ProteinID: XP_010727097
Ensembl: ENSMGAG00000015017
Position
1
AA seq 1174 aa AA seqDB search
MEGNRMLHGCSEEKNRPTSRKETAEGDLKAFWTQLESRKVDLIFEQVQEVLLLLKEKIKN
GTATNQECWQAWTLVNEADLGDLLTLTSVNDVLDEEDTQEPNPKSPKSQHPVTDDNSGNT
VEGSHSKKETVEKSDSGSEEASSEIQRVPLNRQYRIHKCSSACLSNRAVSSYKGENPLKI
PVLFHFQRRHAKADCLSKSLDVHYKAPCGRSLRSFQDVQNYLFETKCDFLFIDHFSFNTY
VLLGRNTVNPEPLVFDLDISNGAESVPISFCNDIDRARLPYFKYRRASWPRGYYLNNLSS
MFLDSCDCTDGCIDRSKCACLQLTARGCRKVSLSLSTKTSRGYSYKRLEGPVPSGIYECS
VSCRCDKMMCQNRVVQHGIQVRLQVFNTEKKGWGVRCLDDIDKGTFVCTYSGRLMSRAEV
QELGGADQDLKEESAVNDRAKLFFQKRKLDSSCSDSEIELVQTGKDDILEQQEPSSDNEN
ESALIHPRNVKTAAVRRLGTRIAVVDNHQLKMEVDTLVHSASSDEDNISQPQHSSKTELT
SGTNKEKERSIQKQKEEDLVEVGQTEPAEMGSAECRRKSLSLKGVACGRSDVLNDKYVVK
PSTKVPKKANCKEEAHRQSKQGIICMDADGDRTLLKNANDENIYILDATKEGNVGRFLNH
SCCPNLFAQSVFVETHNRSFPWVAFFTNRHVKAGTELTWDYGYEAGSMPETEISCWCGVQ
KCRKKTLAGGGSGIRTGDPSSTTPKGAGMSREPLPHHTTLTPPIPARIPYTSQSAARSTT
PSPRAAGRPVPFCRSRRAGKHCGAWNESVREWLRASGAARPSASGAGESREPMRSPAIIS
VTLNGCEKGRTSRSVHLLKKIVETFPVWQADGGFVVEALRLPVPGALQAMAKMVRRTCAF
CSEGEAASIMYVAKEQNIAAHQSCLLFSSGFVESEEYNPENLDLRFDVESVLNELKRGKR
LVCNFCRKKGATVGCEERACRRSYHYFCALCDDAAIETDEVNGVYRVFCSKHDPGNRTNH
YDAANKRKRHASKSSTTMEQMRAEETAEDNRLRILRRKSSRHKVRIDFLRKCKQAGLLDD
IFEEMLDTLHLAQEKLMDDNTSETEYEETVISLFDCGLFENILTNIHSGTEEKIQELLKS
RKRLDNQIELLQELKEVSLPSQESTASTSSTVSE
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaaccgaatgctgcatggctgttctgaagagaagaaccgtcccacttccagg
aaagagacagctgaaggtgatttgaaggcattttggacacaactggaaagtagaaaagtg
gatctcatatttgagcaggtgcaagaagtactgctgctgctaaaggaaaagatcaagaat
ggaactgccacaaatcaagaatgctggcaggcttggacactggtaaacgaagctgatctg
ggtgatcttttaacgttgacaagtgtaaatgatgttcttgatgaagaagatacacaggaa
ccaaatcctaaatcacctaaatcacagcatcctgttacagatgacaacagtggaaacact
gtagagggttcacacagcaaaaaggagacggttgaaaaatcagattcagggagtgaggaa
gcatcaagtgaaattcaacgtgtacctttaaatcgccagtatcggatccacaagtgctcc
agtgcatgtctctccaacagagcagtaagctcctacaagggtgaaaatcctcttaagata
ccagtactgtttcactttcaaagacgccatgcgaaagcagactgcctttcaaaatcactg
gatgtgcattacaaagctccctgtggcaggagtctgagaagttttcaagatgttcaaaat
tatttgtttgagacaaaatgtgatttcttatttattgatcacttctctttcaacacatac
gtcctgttgggcaggaacactgtaaatccagaaccccttgtgtttgatcttgatattagc
aatggagctgaatctgtgcctatttccttctgtaatgacattgaccgtgccagattacct
tattttaaataccggagggcatcgtggcctcgtggatattatctcaacaatttatccagc
atgtttcttgattcatgtgactgcacggatggctgcattgataggtccaagtgtgcatgt
ctgcagctaactgcaagaggctgccgtaaagtttctctgtctcttagtactaaaacgtct
cgtggatacagttacaaaagactggaagggcctgttcctagtggaatttatgagtgtagc
gtgtcgtgcagatgtgacaagatgatgtgtcaaaacagagttgtacagcatggcattcaa
gttcggttgcaagtgttcaacacagagaagaagggttggggcgtccgctgcctggatgat
atcgacaaggggacgtttgtttgtacttactcaggcaggttaatgagcagagctgaagtt
caagagttgggaggtgctgatcaagacttgaaagaggagagcgctgtgaatgacagggca
aagctttttttccaaaaaagaaaacttgactctagctgttcagactctgagattgaactc
gtgcagactggcaaagatgatattcttgagcagcaggaaccttcttctgataatgaaaat
gaatcagctctaattcatccaaggaatgtgaaaactgcagctgtgagaaggcttggaact
agaatagctgttgtggataatcaccagctgaaaatggaggttgatactctggtgcacagt
gccagctcagatgaagataatatttctcagcctcagcattcaagcaaaacagaactgacc
agtggaacaaacaaagaaaaagaaagatccatccagaagcagaaggaagaagatctggtg
gaagttggacagacggagcctgctgagatgggcagtgcagaatgcagaaggaagagtctg
tctctgaagggtgttgcttgtggcagatcagatgtgctgaatgataaatacgttgtgaag
ccgtccacaaaggttccaaaaaaagctaactgcaaagaggaagctcacagacagtcaaaa
caaggcataatttgtatggatgcagatggtgacaggacgcttctgaagaatgctaatgat
gaaaatatctatatactagatgccacgaaagaaggaaatgtgggtcgttttcttaatcac
agctgctgccccaatctctttgcacagagtgtgtttgtagagactcacaacagaagtttc
ccatgggttgctttcttcacaaacaggcatgtgaaagctggaactgaactcacgtgggat
tatggatatgaagctggaagtatgccagagacagagatttcctgttggtgtggagttcag
aaatgcaggaagaaaaccttagcaggcggagggagcgggattcgaaccggtgaccccagc
tctaccacgcctaaaggcgcggggatgagccgagagccgctccctcaccacacgaccctc
acacctccaatccccgcccgcattccgtacaccagccaatcggccgctcgaagcaccacc
ccgtcgccccgcgctgcgggccggcccgtgcctttttgccggtcccgccgggccggtaag
cactgcggcgcgtggaacgaaagtgttagggagtggctgagggcctccggcgcagcgagg
ccgagtgcctcgggagcgggggagagtcgggagccgatgaggagccctgcgattatctcc
gtaacgttgaacggctgtgagaagggacggaccagtcggtccgtccatctgcttaaaaaa
attgtggaaacatttcctgtgtggcaagcagacggtggatttgttgtggaagccttgcgt
cttcctgttccaggtgctctccaggcgatggccaaaatggtgagaaggacgtgtgctttc
tgttcagaaggggaggctgcttctataatgtatgttgccaaagagcaaaatattgcagct
catcagagttgtttgttattttcctctggatttgtggaatctgaagagtataacccagaa
aatctagatttaaggtttgatgtggaatccgtgttgaatgaactcaagagaggaaagcga
ctggtgtgcaatttctgtcgcaagaaaggagccacagtgggatgtgaggagagagcctgc
cgcaggagttaccactacttctgtgccttgtgtgatgatgcagccatagaaacagatgaa
gtaaatggagtctaccgagtgttctgctcaaaacatgacccaggcaacaggaccaatcac
tatgatgcagctaataagaggaaaagacatgcatcgaaatcttccaccaccatggaacaa
atgagggcagaagagacagcagaagataacagattacggatattaagaaggaaaagcagc
agacacaaagtccgaatcgactttctcaggaaatgcaaacaagctgggcttctggatgac
atatttgaagaaatgttggacacccttcacttggcacaggaaaagctgatggatgacaac
acttcagagacagagtatgaggagacggtaatatcgctctttgactgcggactgtttgaa
aacatactgacaaatattcattcagggactgaggaaaaaattcaagaattgctgaaaagc
aggaaaagactggataaccagattgagctactgcaggagttaaaagaagtttctctcccc
tcccaagagagtactgccagtacatccagtacagtgtctgagtaa

DBGET integrated database retrieval system