KEGG   Meleagris gallopavo (turkey): 100551391Help
Entry
100551391         CDS       T01523                                 

Gene name
ADRA1A
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04020  Calcium signaling pathway
mgp04080  Neuroactive ligand-receptor interaction
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100551391 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100551391 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100551391 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100551391 (ADRA1A)
G protein-coupled receptors [BR:mgp04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100551391 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 100551391
NCBI-ProteinID: XP_010721505
Position
24
AA seq 467 aa AA seqDB search
MVFLSGNSSDCSNCTHSAGPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLQSV
THYYIINLAVADLLLTSTVLPFSATMEILGYWAFGRIFCNIWAAVDVLCCTASIMSLCII
SIDRYIGVSYPLRYPSIVTEKRGLLALLCVWALSLVISIGPLFGWKEPAPEDETICQITE
EPGYVLFSALGSFYLPLTIILVMYCRVYVVAKRENKGLRSGLKMEKSRSEAVTLRIHRKN
APETSGATASSKSKHHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFVVMPLGSFFPT
IKPPDTLFKITFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRAQCLPRKHAAKKQSPSFN
LNHPNSQSMGGGKGVVRIPVGSGETFYKISKSEGVCEWKIFSAVQSAPTKNAIPKDKSSC
TAAKVKSKGFLQECCCAGTSGNAVHENCKVPTVKIHTMTLSENGEDV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggttttcctctctgggaactcatccgactgttccaactgcacccactctgcagggccc
gtgaacatttccaaagccattttgctgggtgttattctaggggggctgatcatttttgga
gttttgggtaacattctggttatcctctctgtagcctgccacaggcatcttcagagtgtc
acccactactatataattaatctggctgtagccgacctcctcttgacatccactgtcctc
cccttctctgctactatggagattttgggctactgggcctttggaaggatcttctgcaac
atctgggcagctgtcgatgtgctttgctgcactgcttccattatgagcctctgcatcatc
tcgatagacagatacatcggggtgagctacccactgcgataccccagcatagtgacagag
aagagaggcctcctggctctgctgtgcgtgtgggcgctgtctctggtcatctccattgga
cctctttttggatggaaggaaccagcacccgaagacgagaccatctgccagatcaccgaa
gagcccggctacgtgctgttctccgcgctgggctccttctacctccccctgaccatcatc
ctggtgatgtactgccgagtgtatgtcgtggccaaaagggaaaacaaaggtttgaggtca
gggctgaagatggagaaatctcgttccgaagcagtgaccctacggatccaccgcaaaaac
gctcccgaaacgagcggggccacggccagttctaagagcaagcatcacttctcagtgcgt
ctcctcaagttctccagagaaaagaaagcagccaagaccctgggaattgtagtgggatgc
tttgttctgtgctggcttccattttttgtagtcatgcctcttggttctttctttcctaca
atcaaacccccggacacactttttaaaataacattttggcttggatatttaaacagctgc
atcaaccccatcatctatccatgctccagtcaagagtttaagaaagcgttccaaaatgtc
ctgagagcgcagtgcctcccaagaaagcacgcagcaaagaagcaatccccaagcttcaac
ctcaatcatcccaacagccaaagcatgggaggtggtaaaggtgtggtccgtatccccgtc
ggctcaggagaaaccttctataagatttccaaatctgagggagtctgtgaatggaagata
ttctccgccgtgcaaagcgcgccgacaaaaaatgcgattcctaaagacaagtccagctgt
actgctgccaaagtgaaaagcaaaggtttcctccaggagtgctgctgtgcgggcacttca
gggaacgcggtccatgaaaactgcaaagtgccaaccgttaaaatacacaccatgaccctc
agtgagaacggggaggatgtctaa

DBGET integrated database retrieval system