KEGG   Meleagris gallopavo (turkey): 100551395
Entry
100551395         CDS       T01523                                 

Definition
(RefSeq) retinol dehydrogenase 5 isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100551395
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100551395
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 100551395
NCBI-ProteinID: XP_010725347
Position
Unknown
AA seq 308 aa
MWFYLLLAVLAWALGWLVRDRRTLPSVRDKHVFITGCDSGFGNLLARRLAQRGFRVLAAC
LTPQGADGLQRGCAGHLRTTLLDVTRSDSIRRAAEWVREEVGEKGLFGLVNNAGVANPIG
PTEWMRIEDYQQVMAVNTFGAIEVTLQLLPLLKRARGRVVNTSSVLGRLSANGGGYCVSK
YCIEAFSDSLRRDMYHFGVKVSIVEPGFFKTAVTNLESIEASLRQLWERLAPETRLSYGE
EFFHKCECGRGQRGHPLLLGPHWVGHPPPSSGTPVGLPPLLLGPIRLTTHPLLLGPHWVG
HPLLPGPC
NT seq 927 nt   +upstreamnt  +downstreamnt
atgtggttttatctattgctggcggtgctggcctgggccctgggctggctggtaagggat
cgccgaaccctcccctcagtcagagacaaacacgtcttcatcaccggctgcgacagcggt
ttcggcaacctgctggcacggcggctggcacaacgtggcttccgtgtgctggctgcttgc
ctgaccccacaaggggccgatgggctgcagcgaggctgtgctgggcacctccgaaccacg
ctgctggatgtgacccgctctgatagcatccggcgtgctgcggagtgggtgcgggaggag
gtgggcgagaaagggctctttgggctggtgaacaacgcgggggtggccaaccccatcggc
cccacggagtggatgcggatcgaggactaccagcaggtgatggctgtcaacacttttggg
gccatcgaggtgaccctacagctgctgcccctcctcaagagggcacggggccgcgtggtc
aacacctccagcgtgctcggccgcctctcagccaacggtggtggatattgcgtctccaag
tattgcatcgaggcgttctccgacagcctcaggcgcgacatgtaccacttcggggtgaag
gtgagcatcgtggagcccggcttcttcaagacagccgtgaccaacctggagagcatcgaa
gcatcgctgcggcagctctgggagcgcctggcacccgagacacggctcagctatggcgag
gagttcttccacaagtgtgagtgtgggagaggacagcggggccacccccttcttctgggg
ccccattgggttggccacccacccccttcttctgggacccccgttgggttgccacccctt
cttctgggccccattaggttgaccacccacccccttcttctgggaccccattgggttggc
cacccacttcttcctggaccctgttag

DBGET integrated database retrieval system