KEGG   Meleagris gallopavo (turkey): 104911262
Entry
104911262         CDS       T01523                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5 isoform X2
  KO
K16522  A-kinase anchor protein 5
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgp01009]
    104911262 (AKAP5)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     104911262 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 104911262
NCBI-ProteinID: XP_019471482
Position
5
AA seq 587 aa
MAKAAKEIQMENPSELETPSAGTPCPPLEEQAEKPSMLCFKKRKKSCKKGLTTKDAREGA
SGTSKEKNQCISTDPGEAKTSAQLRPSRGAWAALKSLTKPRRGQKSSSRKKVSSDSQVQL
EMDAEESCAQGLPRKKASTGVKMPCVRFLRGKKKASPTEVVEESEDSVQANEVMGILNKA
IEELEDMAPAEPCDKAESLSPLPAEDMAPVQPCNKAESLSPLPAEDTAPAEPCNNAESLS
PLLAEDMAPAEPCDKVESLSSLLAEDVAPAEPCDKAESLSPLSADVAPAEPCGSAVALSL
LPAEDTAPAESCDKAEALRPLPAEDQHISAEGADAKERSEPSGEGRPEVDEHTECIAQSE
ITSLEPVNEPVQEKLPEGSQSTAQVEEREVTPEAPVSTDQPNGTPEITEVQEIATICKEL
PERDESERNTDLPKEGKSEETTMDFSPSVSKDDAMSVQSSSSHQEKPEVNMGTGVGIVIT
ITEAVDSDDTDSDQTYEPSPVLHHKKQKGNKKSSGSFDFGQKEGPGAGSDAMVEEKGLGE
QGHRTSDQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggcaaaggctgctaaggagatacaaatggagaacccgagcgagctggagactcctagc
gcagggacaccatgccccccattggaagaacaggcagaaaaaccctccatgctctgtttt
aagaagcggaagaagtcctgtaagaaggggctgacaactaaggatgcacgtgagggagct
tctggaacctcgaaggagaaaaatcaatgcatcagcacagacccaggggaggcaaaaact
tctgctcaattgcgaccctccagaggagcgtgggcagccctcaaaagtctcacaaaacct
cggagagggcagaaatcctcttcacggaagaaggtgtcttctgattctcaggtgcagctg
gagatggatgcagaggagagctgtgcacaaggtcttccaaggaaaaaggccagcacaggg
gtgaagatgccctgtgtgcgcttcttgagaggcaagaaaaaggccagccccacagaggtg
gtggaggagtcagaggacagtgtccaagcaaatgaagtgatgggcattttgaataaagcc
attgaagagctggaggacatggccccagcagagccctgcgacaaggctgagtccctcagt
ccactccctgcagaggacatggcccccgtacagccttgcaacaaggctgagtccctcagt
ccactccctgcagaggacacggccccagcagagccctgtaacaatgctgagtccctcagc
cccctccttgcagaggacatggccccagcagagccctgcgacaaggttgagtccctcagc
tccctccttgcagaggacgtggccccagcagagccttgtgacaaggctgagtccctcagc
ccactctctgcagatgtcgccccagcagagccctgtggcagtgctgtagccctaagcctg
ctacctgcagaggacacagccccagcagagtcctgtgacaaggctgaagccctacgcccg
ctgcctgcagaggaccagcacatatcagcagagggtgccgatgccaaagagaggagtgag
ccctcgggagagggcagacctgaagtggatgaacacacagagtgcatcgctcagtcagaa
ataaccagtttggagcctgtcaatgaacctgtgcaggaaaagctgcctgaggggagtcaa
tctacagctcaagtggaagagagggaagtcactcccgaagcgccggtttccacagatcaa
cccaatggcacccctgaaatcaccgaggtgcaggaaatagccacaatctgcaaggagctt
cctgaaagggatgagtcagagaggaacactgatctccccaaggagggcaaatctgaggag
accacaatggatttcagtccatcagtgtctaaggacgatgcaatgagtgtgcagagcagc
tccagccatcaggagaaacctgaagtcaacatgggcaccggcgttggcatcgtcatcacc
atcactgaagctgtggactctgatgacaccgattctgaccagacctatgagccatcccca
gttttacaccacaagaagcaaaaagggaataaaaaatccagtgggagctttgattttggt
caaaaagaaggccctggggctggcagtgatgctatggtggaagagaaaggtctgggcgag
caggggcacaggacttcggatcagtacgagttgctcctcatagaaacagcatcttccctt
gtgaaggcggccatccagtcatccatagagcagctggtcaacgagatggctctggaacag
aataaacacaacagttttctgtga

DBGET integrated database retrieval system