KEGG   Meleagris gallopavo (turkey): 104912965Help
Entry
104912965         CDS       T01523                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104912965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mgp04030]
    104912965
G protein-coupled receptors [BR:mgp04030]
 Rhodopsin family
  Lipid
   Leukotriene
    104912965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 104912965
NCBI-ProteinID: XP_010716121
Ensembl: ENSMGAG00000003936
Position
13
AA seq 335 aa AA seqDB search
MSQAEETSTHVTWNTVKLVVCVILSLSFIIGTPGNCIVIWTVCTKMKQVSPSVLLILNLA
IADILVLITLPIWIYSFADSWVFGIIFCKMLVFIIYCSMYASIFLITALSLERLMAVFYP
LAVQRYKTKEKTSIIMVLIWFLSIALGISIIPFQETDEINGGQQCTCRNYSSTEQKVSYL
LLETLAGFVIPFLIICTSYVCVAKRISKMTYQSKQRSERLITSIVVAFILCWFPHHLFNI
LDIISIEIEHSEEMYLTLEKIVDVGEYISGALVFVSSCINPLLYAFAARKFQNHLRIAKI
SKLFEQMSQTVTDEDKKKSHSVVKQETASVSMENL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagctgaggaaaccagtacccatgtgacatggaacactgtgaaactggtagtt
tgcgtgatattgagcttgtcatttattattgggactcctggaaattgcattgtcatctgg
actgtttgtactaaaatgaagcaagtgtctccttcggtcctgctgatcttgaacctggcc
attgcagatatcctcgtactgattactttgcctatctggatttactcctttgctgactca
tgggtttttggaatcatcttctgcaaaatgctggtcttcattatttactgcagcatgtat
gctagtatatttctgattacagcactgagcttggagagattaatggctgtgttttaccct
cttgctgttcagagatacaaaacaaaggaaaagacttctataatcatggtcctcatttgg
ttcctgtctatagctcttggtatttctatcattccatttcaagagacagacgaaatcaat
ggtgggcagcagtgcacgtgtcgcaactactcttctactgaacagaaagtgtcgtatctt
ttgctggaaactcttgcaggttttgtaattccttttctaattatatgcacctcttatgtg
tgcgttgcaaaaagaataagcaaaatgacttaccagtcgaagcagcgatcagaacggctc
attaccagcattgtggtggcattcattttgtgctggtttcctcatcatcttttcaacatc
ctagatattatttcaattgagatagagcattctgaggaaatgtatttgactctggaaaaa
attgtagacgtaggagagtacatctctggagcacttgtgtttgtcagtagctgcattaac
cctctactttacgcttttgctgcacgaaaatttcagaatcacctgagaattgccaagata
tcaaagctctttgaacagatgagtcagactgtaacagacgaagacaagaaaaagagtcat
tctgtagtcaaacaagagactgcttcagtaagcatggaaaatctctaa

DBGET integrated database retrieval system