KEGG   Meleagris gallopavo (turkey): 104916039Help
Entry
104916039         CDS       T01523                                 

Definition
(RefSeq) N6-adenosine-methyltransferase 70 kDa subunit-like
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mgp03019]
    104916039
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     104916039
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     104916039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_lig_T4_1 GAS
Motif
Other DBs
NCBI-GeneID: 104916039
NCBI-ProteinID: XP_019466709
Position
Un
AA seq 286 aa AA seqDB search
MSDTWSSIQAHKKQLDSLRERLQRRRKQDPLGEGNFGVKSRGFGAGSVGSSVPTPWGGSG
GALPTPLRMGGVPELAPDPALERRLLLHLADVALTLPTDAGAIRGAIDTPETPATQRMVE
SLLQKFAAQELIEVRRGLLAEGPTIVTYADHSKLAAMTGAERGGDGDADVTGRKRRAEQD
NPGGVGVAGTETGKEMVKKSRKQASDVDLEIESLLSQQSTKEQQSKKVSQEILELLNTTT
AKEQSIVEKFRSRGPGRVQEFCDHGTKEECVKATGADRPCRKLHFR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatacctggagctccatccaggcccacaagaagcagttggattcgctgcgggag
cggctgcagcggcggaggaaacaggacccgctcggtgaggggaattttggggtgaaatcg
agaggttttggggcgggttctgttggaagctccgtccccaccccgtggggggggtcgggg
ggggctctaccaacccctctacggatggggggggtccccgaattggcccccgacccggcc
ttggagcgtcggttgctgcttcacctcgccgatgttgccctcactttgcccaccgacgcc
ggagcaatccggggggccatcgatacgcccgagacgccggcgacgcagcgcatggtggaa
agcctcctccagaagttcgctgctcaggagctgatcgaggtgcgccgggggctgctggca
gaaggtcccaccatcgtcacctacgccgaccactccaagttggcggccatgacaggtgct
gaacgcggaggggacggcgacgccgacgtcaccgggaggaaacgtcgagcagagcaggac
aatcccggcggggtcggggtggcggggacggaaacggggaaagaaatggtgaaaaaatcc
cgtaagcaggcgtccgacgtggacctggagattgagagtttgctcagccagcagtccacc
aaggagcagcagagcaaaaaagtgagccaggagatcctggagctgctgaacaccacgacg
gccaaggagcagtccatcgtggagaagttccgctcgcgggggccgggcagggtgcaggaa
ttctgcgaccacggcaccaaggaggaatgcgtcaaagccaccggcgccgaccgcccctgc
aggaagctgcacttccggtag

DBGET integrated database retrieval system