KEGG   Magnaporthe oryzae: MGG_00015Help
Entry
MGG_00015         CDS       T01027                                 

Definition
(RefSeq) catechol O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00350  Tyrosine metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGG_00015
Enzymes [BR:mgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MGG_00015
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MGG_00015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_24 Methyltransf_3 Cons_hypoth95 CmcI
Motif
Other DBs
NCBI-GeneID: 2675128
NCBI-ProteinID: XP_003719132
UniProt: G4NF29
Position
5
AA seq 266 aa AA seqDB search
MSITLNAQDFTGVAYAEQEEVYFNDGREKELLDYVLNHPSVSEIRGHPQRVLDVIDEFGR
NQKYLMNIGEYKGRTVREIIYKHKPATMVELGGYVGYSAVAFAAAAREAGGERYISIEHN
PYFAHVIEKMVELAGLKEFVTVVVGDSTEALKGLHNNGTLKHIDLLFLDHLKPLYTQDLQ
LCEELELVGPGTVLAADNVVKPGNPPYLRYVRSTVAEKRDAKAKAMHMDATGNPNLIYES
QFVEGWEPSGVPDALEITHCVGIESY
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaccctcaatgcccaagactttacaggcgtggcctacgcagaacaagaggaa
gtctacttcaacgatggccgcgaaaaggagcttttggactatgtcctcaaccacccatca
gtgtcagaaataaggggccacccacagagggtcctcgacgtgattgacgagtttggccgc
aatcaaaagtatctgatgaacattggggagtacaaaggcaggacagtccgcgaaatcatc
tacaagcacaagccggcgaccatggtagagcttggagggtacgttggctactcggctgtt
gcctttgcggctgctgccagagaagccggtggcgagcgatatatcagcatcgagcataac
ccttactttgcccacgtcattgagaagatggttgagcttgctggactgaaggagtttgta
actgttgtggtgggcgacagcacggaggcgttgaagggactacacaacaacgggacgctc
aagcacattgatttgttgtttctggatcatctcaagccgctctatacgcaggatctgcag
ctatgtgaggagctggagcttgttgggcctggcaccgtcctcgctgctgataacgtggtc
aagcctggcaacccgccgtatttgcgatacgttagaagtaccgtggccgagaagcgcgat
gcaaaggccaaagcgatgcacatggacgccacaggtaacccgaacctcatatacgagagc
caattcgtggaaggatgggagcccagtggagtacctgatgctctagagattacccattgt
gttggtattgagagctattga

DBGET integrated database retrieval system