KEGG   Magnaporthe oryzae: MGG_00481Help
Entry
MGG_00481         CDS       T01027                                 

Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00330  Arginine and proline metabolism
mgr00332  Carbapenem biosynthesis
mgr01100  Metabolic pathways
mgr01130  Biosynthesis of antibiotics
mgr01230  Biosynthesis of amino acids
Module
mgr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MGG_00481
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MGG_00481
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MGG_00481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 2674712
NCBI-ProteinID: XP_003718581
UniProt: G4NBT9
Position
5
AA seq 444 aa AA seqDB search
MKAPKSLGTVVIKLGTSSIVDETTKKPLLSILTLIVETAVKLREDGHKVVIVSSGAIGVG
LRRMDIAVRPKKHMSKLQALAAIGQCRLMSLWDSLFTQLRQPIAQILLTRNDIADRSRYL
NAQNTVMELLDMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVHAEMLFLMTDVDCLY
DKNPRAHPDAKAIEVVEDIGALSADVSSAGSSLGTGGMFTKIVAARLATSAGVTTIIARA
SNPGNILNIVKWIEANPAATSSRISVNDHTDSFMPRNESGIQPPLHTRFLPSTDPIRDRS
FWILHGLKPHGTVYIDQGAYQALLDKAGLLPVGVVDVEGHFAQQEAVRIVVVEKKLSTPT
PDGKYWEGSTNEVGRALVNYSSAEIARIKGHQSTDIKDLLGYADSEYVVHRAQISFFRRE
SRPVSPTMEMEPITRGIGSYEVTH
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctccgaaatcattgggcactgtggtgatcaagctaggcaccagctccatcgtc
gatgagacgacaaaaaaacctctcctctccatcttgaccctaattgttgagacggccgtc
aagttaagggaagatggacacaaagtcgtcatcgtctcgtcgggtgccatcggcgttggg
cttcgccgtatggacatagccgtaaggcccaagaagcacatgtccaagttgcaggctttg
gcagcaataggacaatgccgcctcatgagtctatgggacagtctcttcacacaattgaga
cagccaatcgcacaaattcttctcaccaggaatgatattgcggacaggtccaggtaccta
aatgcccagaatacagtcatggagctccttgacatgggcgttatccccatcgtaaacgag
aacgacactctcgccgtctcggaaatcaagtttggcgacaatgacacactatccgctatt
actgcagctatggttcatgcagaaatgctattcctcatgacggacgtagattgtctatat
gacaagaatccccgagctcacccagatgccaaggctatcgaggtggtagaggatatcgga
gccttatctgctgatgtgtcctctgccggatcgtctttgggtacgggtggcatgtttacc
aagatcgtggcagcaaggcttgccacctctgcaggagtcaccaccatcatcgccagggcg
tcaaatccgggcaatattctcaacattgtgaaatggattgaggcaaacccagctgccaca
tcgtccaggatcagtgtaaatgaccacacagactctttcatgcccaggaacgaatcagga
attcagcctccattacacacacgattccttccctcaacagacccaatcagggaccggtca
ttctggatccttcacggcctcaagccacacggcacagtctacatagaccaaggcgcgtac
caagcactgttggataaggctggcctactacctgtgggtgtagtggatgtcgaaggacac
tttgcacagcaggaagccgtccggatcgtggtggtcgagaagaaactctcaacgccaacc
cctgacggaaagtactgggagggttctaccaacgaggttggccgagctttggtgaactac
tcatcggccgagatcgccaggatcaagggtcaccaaagcacagatatcaaggatctactc
ggctacgctgacagcgagtacgtcgttcaccgagcgcagatcagcttcttcaggagggaa
agcagaccggtctccccaacaatggagatggaacccatcacccgcggaattggaagctac
gaggtcacacactaa

DBGET integrated database retrieval system