KEGG   Pyricularia oryzae: MGG_00521
Entry
MGG_00521         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
Organism
mgr  Pyricularia oryzae
SSDB
Motif
Pfam: GTP_EFTU AAA_29
Other DBs
NCBI-GeneID: 2674654
NCBI-ProteinID: XP_003718536
UniProt: G4NBP4
Position
5
AA seq 873 aa
MSVFTYDPDPPRVSSPWLQSADPGKSRESSPVPAGPTASGLLSDYGVTKLEAEPQEGPTE
YKLHLLLRQRRKFRYMSTTNRVAGSQLPRPTPAEPKALRHRATSVSTSTQTRQARLLQLT
TQLFWRLRQSSPYHASTSQEVVIPQLADDFTSSTVSIKPGKPLPGLEESRGALYEIGVAD
DGTLVGLTKDELDESFTNLRIMAASLGCVVEILRRVVVGECEWVDDTPSKVAHREDLWVA
EALVTPNKGSTERIEGNGNSNSSTHQGAAKLDPTPSDGPSATEQLRVTLTGPTTSGKSTL
LGTLSTGTLDNGHGKSRLSLLRHRHELASGVTSSVAQELIGYRDNEVINYDNGNIESWIG
IHDFTGDGRLVFVSDSAGHPRYRRTILRGVVGWAPHWTLLCLAADDDEGVSTISGLNMPT
QDGTDCPTSGIDLARAHLELCLKLELPLAIVITKVDKGTKPGLQKILSKVLTSIKQANRS
PRLLHPGRSSNLDTAQISDEDLDSVKKAMGPMFASGDLLGTVPIVLTSAVNGTGIGLVHA
LLKTLPLPAAPTSQDLTGPALNPEQPASLFHIEVEFSLPASHASLGGSANDQADLGTVVA
GYLRFGTISVGDQVVLGPFPSDEDDSKGCAPPEGRHSPASYGISLTHPSATELSRFATRT
PVSASTIKGEWHTAHVVSLRNLRLPVLKLEGGQAGTVGLVIDPPKEPRMDDSLFETVPPA
PPKIRKGMVLAIPSKHMLDGNISLQAASGLTAVFPGPEAASLSAGNLVNIYVASVRATAR
VLRVYGTSGSVGPYGSASPHEDEDDVFGFNNGHDEMETQGDQPSAHKNVEVRLELLNNRE
WIELGSRIVILEGSRPESSGLEGFVGTVVEVVD
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgtcagtcttcacgtacgaccctgacccgccgcgggtttcgtctccctggctccagtcc
gcagatccggggaaatcgcgcgagtcttcgccggtccccgccggccccactgcatcggga
ctcctctcggattatggggttactaagctggaagctgaacctcaggaaggaccgacggag
tataaattgcatctactccttcggcagaggcgcaagttccggtacatgagtactacgaac
cgtgttgccggttcccagctgcctcggccaactcccgctgaaccaaaggcgctcaggcat
cgtgctactagtgtttctacttctacccagacacgccaggcacgtctactgcaactgaca
acccagctcttctggaggttgcgtcagtcttcgccttatcatgcctcaaccagccaggag
gtggtgatcccacagcttgcagacgactttacttcttcaactgtctcgatcaagcctggg
aaaccccttccgggccttgaggaatccaggggtgccttgtacgagattggcgtggctgac
gacggtaccctcgtcggactgaccaaggatgagttggacgaaagtttcaccaacctacga
attatggctgctagcttaggatgcgtggttgagattctgaggcgtgttgttgtgggtgag
tgtgaatgggtggatgatacaccatctaaagtcgctcaccgagaggacctatgggtcgcc
gaagctctcgtgactccaaacaaaggttctaccgagcgcatcgagggcaatggcaactcc
aacagttctactcatcagggtgcggccaagttggatcccacaccaagcgatggcccatca
gctaccgaacagctgagagtgacgctaacagggccaacaacctctggtaagtcgaccttg
cttggcacattatccaccggtacactggacaatggccatggcaaaagtagactcagcttg
ttgcggcaccggcacgagcttgcatcaggcgtcaccagctcagtggcccaagagcttatt
ggctacagagacaatgaagtcatcaactatgataatgggaatatcgagtcctggattggg
attcacgatttcaccggagacgggcgcctagtattcgtgtccgattccgccggccaccca
cggtaccggcgaacaatccttcgcggggtcgtggggtgggcacctcactggactctactc
tgcttggccgcggacgatgatgagggtgtttccaccatctctggtctgaatatgccgacc
caagatggaactgattgcccgacgagtggaatcgatttggcacgagcgcaccttgagctc
tgccttaagcttgagctacccctagccatcgtcatcaccaaagttgataaaggcaccaaa
cccggtctacaaaagatactgagcaaagttctcactagcatcaagcaagcaaacaggtct
cctcgactccttcacccagggcggtccagcaacctcgacactgctcaaatatccgacgag
gacttggatagcgtgaagaaagccatggggccaatgtttgctagtggtgacttgctcggt
accgtccctatcgtgttgactagcgcggtgaacggcaccggcattgggctggttcatgca
ctattgaaaactctgccattgcctgctgcacctacctcccaggatttgactgggccagcc
ttgaatccggaacaacccgcgagtctatttcacattgaggtcgagttcagcctaccggcg
tcccacgcatctctaggtggaagcgcgaacgaccaagcggacctgggaaccgttgttgca
ggttatcttcggtttggaaccatatcggttggagatcaggtcgtccttggccccttccca
tcggatgaggatgacagcaaaggctgtgctccgccggaaggccgacattcgcctgccagc
tatggaatatctttgacccatccttcggctacggaattgagccgcttcgcgacgcgcact
cccgtttcggcgtccacaatcaagggagagtggcataccgcccacgtcgtgagtctgcgc
aacttacgccttcctgtcctcaagctcgaaggagggcaagctggcactgttgggcttgtc
atcgacccgccgaaggaaccccggatggatgacagcctgtttgaaacagtgcctccagct
cctcctaagatcaggaaagggatggtattggccatcccgagcaagcacatgctcgacgga
aacatctcgttgcaggccgccagtggcctgactgcggtctttcctggtccagaagcagcc
tctctttctgccggtaacctagtaaacatttacgttgctagtgtccgggccacagcaagg
gttttgcgggtttatggaacgtctggaagcgtaggcccctacggcagtgcatcgcctcac
gaagacgaggatgatgtctttggtttcaataatgggcatgatgagatggagacgcaaggt
gaccagccttcagcccacaaaaacgtagaggttcgcctcgagttgctgaacaatagagag
tggatcgagcttggctcacgcattgtgattctggagggaagtcggcctgaaagctctggc
ctggaggggtttgtaggtaccgtggtggaagtggtggattag

DBGET integrated database retrieval system