KEGG   Pyricularia oryzae: MGG_00587
Entry
MGG_00587         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
Organism
mgr  Pyricularia oryzae
SSDB
Motif
Pfam: bZIP_1 bZIP_2
Other DBs
NCBI-GeneID: 2675161
NCBI-ProteinID: XP_003718455
UniProt: G4NBA9
Position
5
AA seq 333 aa
MISHHLYPAVPTTFDPHESYYDASRMSHHYYSAEDNSAKLPPPVNMFAMPQHHHYAAYAP
APAPRQYSGTSSAFSASANPDEDWTKISDLAERRRIQNRIAQRNYRKKLKRRLEDLERRA
GSSDGASTDGNEKTTTTTTSKASTASSSTKSGSKARSPKKATKQQSSPPPAALSPPKTYP
EQFTPPMNPDDELLFAQPYASEPRDRSHSPPSLFYTYPPPEDMMLPYGATTSPPYTAGEY
LVPTTVPVTLPSMTHFSDAIKREPSYGEEMSPYMGNYGYMPGIEVSQAAPYDNSNPHTPP
LSHGFDHSTSCSDSGYEYPTTPLSMPASPGMIQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgatcagtcatcacctctaccctgctgttcccaccaccttcgatcctcacgagtcctac
tacgacgcctcgcgcatgtcccaccactactacagcgcagaagacaactcggccaagctg
ccaccgccagtcaacatgttcgccatgccccaacaccaccactatgccgcctacgcgccc
gctccggctcctaggcaatactcgggaaccagcagcgcatttagcgcctcagccaacccg
gatgaggactggaccaagatctccgaccttgcggagcgcaggaggatacaaaaccgcatt
gcccagcgcaactaccgcaagaagctcaagaggagactggaggaccttgagaggcgtgcc
ggatcttcagatggtgcttcaaccgacggcaacgagaagaccaccaccaccacaacctcc
aaggccagcacagcaagctccagcaccaagagcggcagcaaggctcgctctcctaagaag
gcgacaaagcagcaatcttcaccaccccctgccgctctctcgcctcccaagacttacccc
gagcaatttactcctcccatgaaccctgatgatgagcttcttttcgcacaaccgtatgcg
tcagagccgcgggaccgcagccacagcccgccttcgttgttctacacctacccgccgcct
gaggacatgatgctcccatacggcgccacaacctcgccgccatacacggccggcgaatac
ttggtgccgacaacggtcccggttactttgccttcaatgacacacttcagcgatgccatc
aagcgggaacccagctatggcgaggagatgtcgccctacatgggcaactatggctacatg
ccggggatcgaagtcagccaagccgcgccatacgacaactcgaatcctcatacaccaccg
ttgtcgcacggattcgaccactctaccagctgctcagactctggttacgagtacccgacc
actcctttatccatgcctgcctcgccgggcatgatccagtaa

DBGET integrated database retrieval system