KEGG   Pyricularia oryzae: MGG_01327
Entry
MGG_01327         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
Organism
mgr  Pyricularia oryzae
SSDB
Motif
Pfam: zf-RING_2 zf-RING_11 zf-C3HC4_2 zf-rbx1 zf-RING_5 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-ANAPC11 Zn_ribbon_17 Prok-RING_4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 2679367
NCBI-ProteinID: XP_003714251
UniProt: G4MYL9
Position
2
AA seq 507 aa
MSLVDISNVVLLLNNPAQSSQGSGPSTVIKNISAISNQMAYSSRFAENLVTLASSYVTSS
QNIQGLLYVPDLSPKDPCHKKVASMVPSMVTRRANLPPASFNLVGLAPWISTECTRSYLA
SARVDPIRAFIFYRDTNSTDAPPPADADLWDLDEDDSWKIQNRFPVFAVPGRVGAEMMTQ
LSLYSGNITTVPFGDEISNMYDPREEDYVRIWTTMNVNVDTSFSTFWISIPIFIGVLVGI
VLATSIFLHCVARKRRSSLRKRVQTGEVNLEALGIKRVKVPLNHVHNFPIFTYANHYDNP
PPGSPTLASAPSTIEQAPSSTGLDLNSLSDQPECLICLQPYVDRETIIRELPCGHIFHPD
CIDEFLSEFSSLCPLCKTCMLPKGYSPRITNNMVRREIATRKLRERIVISDDEERYVSSS
TDKKLGLTWGSTRKKHVPRTQPADHDRDTTQPDDIPGVEGRASPKTRTRRRMRELAGPDI
EGGLPNSQANQSIWQKTKGTIFPQFKG
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtccctcgtcgatatcagtaatgttgtccttttgctcaataatccggcccagagtagc
cagggctccgggccgagcacggttatcaagaacatatcggccatctcaaatcaaatggca
tactcgtcacggttcgcagagaacttggtaaccctggcatcatcatatgttacctcgtcc
caaaacattcaggggcttctctacgtccctgacctgagcccaaaagacccatgccataag
aaggtcgcgtctatggtgccttcgatggttacccgtcgggccaatctcccacccgcatct
tttaacctcgttggcctcgcgccgtggatcagcactgaatgtactcggtcctacctcgcg
tctgcgcgcgtggacccaatccgtgctttcatcttttaccgggacacaaacagcaccgat
gccccgcctcctgcagatgctgacctgtgggacctggatgaggatgactcctggaagatt
caaaacaggtttcccgtctttgccgttccaggtcgcgtcggcgccgagatgatgacccaa
ctcagcctttacagtggtaacatcaccacggtaccatttggtgacgaaatctccaacatg
tacgacccgagggaggaggattatgtgaggatatggacgaccatgaacgtcaacgtcgat
acctccttcagcaccttttggatatctatccctatcttcatcggcgtcttggtcggcatc
gttctcgcaacttcgatcttcctgcactgtgttgcccgcaaaagacgctcgagcttgcgg
aagcgagtacagaccggcgaagttaacctcgaagcactgggaatcaagcgggtcaaggta
ccgctcaatcacgtgcacaactttccaatattcacatacgcaaatcactacgataaccca
ccgccaggatcaccgaccctcgcctccgcgccgtcaacaatagaacaagcaccgtcgtcc
accggcttggacttgaacagtctcagcgaccaacccgagtgcctcatctgcctgcagcct
tatgtcgacagagaaacaatcatccgcgaactgccgtgcggacatatattccaccccgac
tgcatagacgagttcttatccgagttcagctccctatgccctctctgcaaaacgtgcatg
ctacccaagggctactccccacgtatcacaaacaatatggtgcgtcgtgagatcgcgacg
aggaaactgcgtgagcgtatagtcatcagtgacgatgaggaacgttacgtcagcagtagc
accgacaaaaagctggggctcacttggggcagcacaaggaagaagcacgtacctcgcaca
caaccggcggatcacgacagggacacaacccagcctgacgatattccaggcgttgaaggg
agagcaagtcccaagacccggacgcggcgaaggatgagggagctcgcgggaccagatatt
gagggtggcctacccaacagtcaggctaaccaatcgatctggcaaaaaaccaagggcacc
atattcccgcagttcaagggatga

DBGET integrated database retrieval system