KEGG   Pyricularia oryzae: MGG_01519
Entry
MGG_01519         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
  KO
K11090  lupus La protein
Organism
mgr  Pyricularia oryzae
SSDB
Motif
Pfam: La RRM_1
Other DBs
NCBI-GeneID: 2679162
NCBI-ProteinID: XP_003714493
UniProt: G4MT27
Position
2
AA seq 427 aa
MSEQETKIEAAVAVEPTVTAEVEKPQEDTKVEDAPAAPSGETAEQSEQAPSEDTKEQPEV
ETVDAVENTESATTESSDNILKTTAKHSQDGSKNTKFDPSVLPESNDPNEIRKQVEFYFS
DSNLSQDKFLWTQVGGTENKPMKLSVIHNFGRMRRFKSYEAVVAALRESKVLDVAGEAGE
ETIVRKNAYDPARGNKSMVSSVYVKGFGDEEPDTQIKLEKFFGDFGFEISSVRLRRTDKK
LFKGSVFVEFASPEEAKKFLELDPKPKWQDHDLKIMSKIAYCEEKNEQIRAGVIKPSERQ
AKFYEGKVSGARGGRGNSRGGNGNFNKREGGDKKDFGGRGGRGGRGRGRDNGRGRGRGAR
GGSRGGFRGGQRDGEKEAPREAPKPSNGNDVKPMIHSSAPSTNGKRARDSDSSAQEPPAK
KVDTGSS
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcgagcaagaaacaaagattgaggctgcggtggcggtagagcccactgtcactgcc
gaagttgagaagcctcaggaggataccaaggtggaagacgctcctgctgcgcctagcggt
gagactgcagagcagtctgagcaagccccgtcagaagacaccaaggagcaacccgaggtc
gagacagtagacgccgtcgagaataccgagagcgcaacaacagagagctctgacaatatc
ctgaagactacggccaagcactctcaggatggttccaaaaacacaaagtttgacccgtcg
gtgctgcccgagtcaaacgaccctaatgaaatccgcaagcaggttgagttctactttagc
gatagcaatctttcgcaagacaagttcctttggacgcaggttggaggtaccgagaacaag
cctatgaagcttagtgtcatccacaactttgggcgcatgcggcggttcaagtcctacgag
gctgtcgtcgcagctctccgcgagagcaaggtgctcgacgttgccggcgaagcaggcgag
gagacgatcgtccgcaagaatgcttacgacccggctcgtggcaacaagtccatggtttcg
agtgtctatgtgaaagggtttggcgatgaggagcctgacacacagatcaagcttgagaag
ttctttggcgatttcgggttcgaaatctcatccgttcgtctgcgacgtaccgacaagaaa
ctcttcaagggctcagtcttcgtcgagttcgccagccctgaggaggccaaaaagtttttg
gagcttgaccccaagcccaagtggcaagatcatgacctgaagatcatgtccaagattgcc
tattgtgaagaaaaaaatgagcaaatcagggccggcgtcatcaagccatccgagagacag
gccaagttctatgagggcaaggtcagcggggctcgaggtggacgaggcaactctaggggc
ggcaacggcaacttcaacaagcgggagggtggcgacaagaaagactttgggggcagggga
ggccgtggtggccgtggccggggtcgtgacaatggtcgcggccggggtcgtggtgcgcgg
ggaggtagccgtggtggtttccgcggaggtcagcgtgatggcgagaaggaggctccaagg
gaagcccctaagccgtccaatggcaacgatgtcaagcccatgatccattccagcgctccc
tcgaccaacggcaaacgagcaagagactctgattcttccgcccaggaaccgcctgccaaa
aaggttgacaccgggtcgtcatga

DBGET integrated database retrieval system