KEGG   Pyricularia oryzae 70-15: MGG_01728Help
Entry
MGG_01728         CDS       T01027                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mgr  Pyricularia oryzae 70-15
Pathway
mgr00670  One carbon pool by folate
mgr01100  Metabolic pathways
mgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MGG_01728
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     MGG_01728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 2679748
NCBI-ProteinID: XP_003714725
UniProt: G4MV96
Position
2
AA seq 631 aa AA seqDB search
MHIRDMLAETEKTGKPSFSFEYFPPKTAQGVQNLYDRMERMYHFGPKFIDITWGAGGRIA
ELTCEMVTQAQTYFGLETCMHLTCTDMGVEKVNDALSKAYKAGCTNILALRGDPPRDKEK
WEAAQDGFNYAKDLVSHIRKTYGDHFDIGVAGYPEGCDDNKDEDLLLDHLKEKVDMGASF
IVTQMFYDADNFVRWVGRVRERGITVPIIPGIMPIATYASFLRRANHMQARIPEEWLQRL
EPIKTDDAAVRIVGRQLVVELCRKILAAGIHHLHFYTMNLAQSTALILEDLDWLPSPNKP
LKHALPWKQSLGLGRREEDVRPIFWRNRNKSYVMRTQDWDEFPNGRWGDSRSPAFGELDA
YGIGLLGTNEQNRKKFGEPKSVKDIATLFVRYVQKEVDTLPWSESPLDAEAEQIRDDLID
LNLRGLITINSQPAVNGVRSTHPIHGWGPPNGYVYQKAYLELLVHPAIFEQLKERIHDHP
DLTYYAVTKSGNLHTNATYEGPNAVTWGVFPGKEIVQPTVVENISFLAWKDEAFQLGMEW
ARCHDQNTPSRILIQSMMQEWYLVNIVNNDFHAPRTIFDTLKGLTVPDIDTEIVPPALPT
AVPEAAAINGERNGERNGAQANGATAAVTAS
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgcatatccgggatatgttggccgagaccgagaagacgggtaaaccgtctttctcgttc
gagtacttccctcccaagacggcacagggtgtgcagaacctgtacgaccgtatggagcgc
atgtaccactttggccccaagtttattgacatcacctggggtgctggtggccgcattgcc
gagcttacctgcgagatggtcacacaggcgcagacctactttggcctcgagacttgcatg
catctcacatgcaccgatatgggtgttgagaaggtcaacgacgctctttccaaagcatac
aaggctggctgcaccaatattctcgccttgcgtggtgatccaccacgtgacaaggagaag
tgggaggctgcccaggatggctttaactacgccaaagacctcgtatcccacattcgcaag
acgtacggagaccacttcgatatcggcgttgccggctaccctgagggttgtgacgataac
aaggacgaggacctgcttctcgaccacttgaaggaaaaggtcgatatgggtgcctctttc
attgtcacgcagatgttttatgacgccgacaactttgtgcgttgggttggccgagtacgc
gaacgaggcatcaccgtccccatcataccaggtattatgcctattgcaacatacgccagc
ttcttgcgtcgggcgaaccacatgcaggcgagaatccccgaggagtggttgcagcgcctt
gagcccatcaagacagacgacgctgcggtgagaattgtgggtaggcagctggttgtggag
ctttgccggaagatcttggccgccggcattcaccacttgcacttctatacaatgaacctc
gctcagtcgacggccttgattctggaggaccttgactggctgccatcgccaaacaagccg
ctcaagcacgccttgccctggaagcagtctctgggtctcggacgacgggaggaggacgtg
cgtcccatcttctggcgtaaccgcaacaagtcgtacgttatgaggacccaggactgggac
gagttccccaacgggcgctggggtgactccagatctccggcgttcggtgagcttgacgcc
tacggcattggattgctgggaacaaacgaacagaacaggaagaagttcggcgagccgaaa
tcggtgaaagatatagccactttgtttgtgcgatatgtccaaaaggaagtcgacacgctt
ccgtggagcgagtccccacttgacgcagaggcagaacaaatcagagacgacctgatcgat
cttaacttgcgtgggctgatcacaattaactcgcaacccgccgttaacggtgtcagatca
acccaccccatccacggttggggcccaccaaacggctatgtctaccaaaaggcttaccta
gagctgcttgtccacccggccatttttgagcagctcaaggagcgaatccacgaccacccg
gacctgacatactatgccgtgaccaaatctggaaatctgcataccaacgcaacttatgaa
ggacccaacgctgtcacatggggtgttttcccgggcaaagagattgtacagcccactgtt
gtcgagaacatcagtttcctggcctggaaggatgaggctttccaacttggaatggaatgg
gcccgttgtcatgatcaaaacactcccagccgcattctgatccagagcatgatgcaagag
tggtatcttgtgaacattgtgaacaacgatttccatgcgccacggaccatcttcgacacg
ctcaagggcctcactgttcccgatatcgacaccgaaatcgtcccgcctgcgcttcccact
gccgtccctgaggctgctgccatcaacggcgagcgtaatggcgagcgtaatggcgcgcaa
gccaacggagctaccgcagctgttactgcgtcttga

DBGET integrated database retrieval system