KEGG   Pyricularia oryzae: MGG_01745
Entry
MGG_01745         CDS       T01027                                 

Definition
(RefSeq) zinc finger protein gcs1
  KO
K12492  ADP-ribosylation factor GTPase-activating protein 1
Organism
mgr  Pyricularia oryzae
Pathway
mgr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MGG_01745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgr04131]
    MGG_01745
Membrane trafficking [BR:mgr04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    MGG_01745
SSDB
Motif
Pfam: ArfGap Tape_meas_lam_C DUF4048
Other DBs
NCBI-GeneID: 2679183
NCBI-ProteinID: XP_003714742
UniProt: G4MVB3
Position
2
AA seq 403 aa
MASKGMWEVDPETRSKLLAIQKESKNSLCCDCGAPSPQWASPKFGIFICLSCAGVHRGLG
VHISFVRSISMDAFKAAEIERMRLGGNERWREFFEKHADTELRGISWDDATIAERYGGEA
GDEYKERLSALVDGREYVPGEKKKAAPAENTNRSTAPLGGSADGSKNGGGGGRFRDDPSL
GGSRSESPSGGATSGGKTRVDDKYFARLGADNASRSEDLPPSQGGKYAGFGNTPAPAPGG
AGGNTALPSMDELQNNPVAALSKGFGWFASTVTKTATTVNNNYIQPTAKQIADSDFAAQA
RNTAGTVGRAAQQGAKSAQTSFNRFVEGPDSRQYQQVRQAPIDETRKGFWDDFSDIPEQQ
QKQQPKPSSIGTAAMGKGGSGGAGGPGSASASQTAKKDEWDDW
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcctccaagggcatgtgggaggtcgacccggagactcggtcaaagctcctcgcgatc
cagaaagagtccaagaacagcctgtgctgcgactgcggcgccccgtctccgcagtgggcg
tcacccaagttcggcattttcatctgcctgtcatgcgctggcgtgcaccgaggcctgggc
gtgcacatttcgtttgtgcggtccatctcgatggacgcgtttaaggcggccgagattgag
cgaatgcggcttggaggcaacgagcggtggcgcgagttcttcgagaagcacgccgacacg
gagctgaggggaatctcgtgggacgacgccactatcgcggagcgctacggcggtgaggcg
ggcgacgagtacaaggagcgcctcagcgcgctggttgacgggcgcgagtacgtccccggg
gagaagaagaaggctgctcccgccgagaacaccaacaggtcgactgcgccgcttggtggc
tccgcggacgggtccaagaatggtggcggtggtggcaggttccgggacgacccgtcgctc
ggcggcagcaggtctgagagcccaagcggcggcgcgacgagtggaggaaagacgagggtg
gatgacaagtactttgctaggctcggggccgacaacgcctcgaggtcagaggacctgccg
ccgagccagggcggcaagtacgccggatttggaaacacgccagcgcctgcgccaggagga
gccggcggcaacacggctctgccctcaatggacgagctgcagaacaacccggtggctgca
ctctccaagggctttggctggttcgcatcgaccgtcacgaagactgccactacagtgaat
aataattatattcagcccaccgcaaagcagatcgcagattcggactttgcagcacaggct
cgcaatactgcaggtacggttgggcgagcggcgcagcagggagccaagagcgcacaaacc
agcttcaaccgatttgtcgaggggccggacagccggcaatatcagcaagtgcggcaagcc
ccgatcgacgagacccgcaaggggttctgggatgacttttccgacatccctgaacaacag
cagaagcagcagccgaagccaagctccattggcaccgcggccatgggcaagggtggaagc
ggcggtgcaggaggacccggaagtgcttcggctagccaaacggccaaaaaggatgaatgg
gatgattggtag

DBGET integrated database retrieval system