KEGG   Pyricularia oryzae: MGG_02465
Entry
MGG_02465         CDS       T01027                                 

Definition
(RefSeq) Delta(24(24(1)))-sterol reductase
  KO
K00223  Delta24(24(1))-sterol reductase [EC:1.3.1.71]
Organism
mgr  Pyricularia oryzae
Pathway
mgr00100  Steroid biosynthesis
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MGG_02465
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.71  Delta24(241)-sterol reductase
     MGG_02465
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-GeneID: 2681562
NCBI-ProteinID: XP_003709259
UniProt: G4MRX8
Position
1
AA seq 588 aa
MSSRYSLRQTPRKKELFEGMVETPARRSTRRKSQFPETDGDSSSAAESEAVAKPANTTRR
RVPKFIEHIDETAESDAPSEYSPVSATAPNLSNGDEMARRKVSPDGVAATSDVKIKTEET
PETEPLIDGKLKPKAVDGWIPGTDHRIDSSGFKDFGGPLGVTTMMICFPLLMYYMWIGST
YYNGKFPLPGDGESLGDFVKKLGTLAYTGAFPHLRAWVMFWTFFIFQGTLYCIAPGVWGK
GKPLAHEGGKQLDYYCSAQWSWYITILTASGLHLSGFFPLYTIIDEFGSIMSVCIISGFL
ISIVAYFSAIQRDAQHRMTGSFLYDFFMGAELNPRMFGILDFKMFFEVRLPWFIMFLTTL
GLCARQYEQYGYVTGEAYFVLMAHFLYANACAKGEELIITTWDMYYEKWGFMLIFWNIAG
VPLTYVHCTLYLANHDPSEYAHSKPVLALMFIGYLFVYWVWDTCNSQKNRFRAMERGHLV
PRKSFPQLPYQTIQNPRKIPTQTGDSLLADGWYGMARKVHYTCDLYFALNWGLITGFASP
FPWFYPVFFAGMIVHRAARDIARCREKYGPAWEEYEKQVPYLFIPYVI
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcttccagatattcactacggcagacccccaggaaaaaggagctcttcgagggtatg
gtcgagactcctgctcgtcgctccactcgtagaaagtcacagttccccgagaccgacggt
gattccagctcagctgcagagagcgaagctgttgcaaagccagccaacactactcgccgc
cgtgtacccaagttcattgaacacatcgacgagaccgccgagtccgacgctccttcagaa
tactcacccgtctccgccactgcccctaatttgtcgaacggcgacgaaatggctcggagg
aaggtctcgcccgacggcgttgccgcgactagcgacgtcaaaatcaagaccgaagagacc
ccggagacggaaccccttatcgatggaaagctgaaacccaaggctgtcgatggctggatc
ccgggaactgatcaccgcatcgactcctccggcttcaaggactttggcggacctctcggt
gtaacaaccatgatgatctgctttccgctgctcatgtactacatgtggataggatccacc
tactacaacggcaaattccccctgccgggtgatggcgagagtctgggtgactttgtgaag
aagctaggcacgttggcatacacaggggcgttcccccatttgagggcctgggttatgttc
tggacctttttcattttccaggggaccctctactgcatcgccccgggtgtctggggcaag
ggaaaaccccttgctcacgagggcggcaaacagcttgattattactgctcggcacagtgg
agctggtacatcactattctcaccgcgagtggcctacacctgagtgggttcttcccgctg
tacaccataattgatgagttcggatctattatgagcgtctgcatcatctccgggtttctc
attagcatcgtcgcctacttctcggccattcagcgagacgcccagcatcgcatgacgggc
tcctttctgtacgacttcttcatgggtgctgagctcaacccgcgcatgtttggcatcctc
gatttcaagatgttcttcgaagtccgcctcccgtggttcatcatgttcctgacgacgctg
ggactgtgcgctcggcagtatgaacagtatggctacgtgactggcgaagcatactttgtc
ctcatggcccactttctctacgccaacgcctgcgccaagggcgaggagctcatcatcacc
acttgggatatgtactatgagaagtggggcttcatgctcatcttctggaacattgctggt
gttcccctgacatacgtccactgcaccctttacctcgccaatcacgacccctccgagtac
gctcacagcaagccggtcctcgcccttatgttcattggctacctgtttgtctattgggtc
tgggacacatgcaactcgcagaagaaccgcttccgcgccatggagcgtggccacctggtc
cctcgcaagtcgttcccccagcttccctaccagacgatccagaacccccgaaaaatccct
acccagactggagactctcttctggccgatggctggtacggcatggcccgcaaggttcac
tacacctgcgatctctactttgcgctcaactggggtcttattactggcttcgcgagccct
ttcccgtggttctaccctgtattcttcgctggaatgattgttcaccgcgcagctcgtgac
atcgctcgctgccgcgaaaagtacgggcccgcctgggaggagtacgagaagcaggtcccc
tatctcttcatcccctacgtcatctaa

DBGET integrated database retrieval system