KEGG   Pyricularia oryzae: MGG_03136
Entry
MGG_03136         CDS       T01027                                 

Definition
(RefSeq) 60S ribosomal protein L10
  KO
K02866  large subunit ribosomal protein L10e
Organism
mgr  Pyricularia oryzae
Pathway
mgr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MGG_03136
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mgr03011]
    MGG_03136
Ribosome [BR:mgr03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    MGG_03136
  Archaea
    MGG_03136
SSDB
Motif
Pfam: Ribosomal_L16
Other DBs
NCBI-GeneID: 2676714
NCBI-ProteinID: XP_003716862
UniProt: G4NAV1
Position
4
AA seq 219 aa
MARRPARCYRYCKNKPYPKSRFNRGVPDPKIRIFDLGRKRATVDDFPLCIHLVSNEYEQL
SSEALEAARICANKYLVKNAGKEGFHLRVRAHPYHVVRINKMLSCAGADRLQTGMRGAWG
KPNGTVARVNIGQIILSVRTRDSNRALALEALRRSQYKFPGRQKIIISKNWGFTPLRREE
YLEKKAAGRVKVDGAYVQFLANHGSLENNMKRFPEAFAA
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcccgtcgtcccgctcgttgctaccggtactgcaagaacaagccgtaccccaagtcg
cggttcaaccgtggtgtccccgaccccaagattcgtatcttcgacctgggccgcaagcgt
gctaccgtcgatgacttccctctgtgcatccacctcgtctcgaacgagtacgagcagctg
agctccgaggctcttgaggccgcccgtatttgcgccaacaagtacctggtcaagaacgcc
ggaaaggaaggtttccacctgcgtgtccgcgcccacccgtaccacgtcgtccgcatcaac
aagatgttgtcgtgcgctggtgccgatagactgcagaccggtatgcgtggtgcttggggt
aagcccaacggcactgtcgcccgtgtcaacatcggccagatcatcctgagtgtccgcact
cgtgactccaaccgtgctcttgccctggaggctctccgtcgctcgcagtacaagttcccc
ggtcgccaaaagatcattatctccaagaactggggtttcacccctctccgtcgcgaggag
taccttgagaagaaggctgctggtcgcgtcaaggtcgacggtgcttacgttcagttcctt
gccaaccacggttccctcgagaacaacatgaagcgcttccccgaggcctttgcagcttaa

DBGET integrated database retrieval system