KEGG   Pyricularia oryzae: MGG_03743
Entry
MGG_03743         CDS       T01027                                 

Definition
(RefSeq) IQ calmodulin-binding domain-containing protein
Organism
mgr  Pyricularia oryzae
SSDB
Motif
Pfam: IQ
Other DBs
NCBI-GeneID: 2676794
NCBI-ProteinID: XP_003716135
UniProt: G4N6E6
Position
4
AA seq 641 aa
MAEDKSSEPVHADAGRAELLPSPPKRPRSAACQESTGTKPEANDSSESRQKYLESLIPPS
TEVFNRIACIQNHREDEIRRMSREHKRPSTGSKSPTQPSHATHSAGRPAVEEATAGSRPT
IIDDILLTRAATLIQRTYRGYRTRRQMSGLTVDADTRWAHALREARFREITKPRPRSWSG
EAAGGVGAANPQNGDAGKRSTAARRNWRKAAIVARRAGWDEDSPSGSSSDESIVSLRSNM
DEEERKAARRRRQESRARMKKAAQTMGLQYFLEMVDQKHRYGSNLRTYHDEWKKSNTHEN
FFYWLDFGEGSNLEMEACPRDRLEREQVRYLSREERQYYLVRIDAEGRLCWAKNGARIDT
TEDWKDSIHGIVPKDDITPAYSPELGQKARAPGRSITGGTSSGSADSRASDSELEAARAA
KYANPTLDEAKGIKKVSHVSAATIFNKMLRKSVRKNTWIFVADTSFRLYVGIKDSGAFQH
SSFLQGGRISAAGLIKIKNGRLKSLSPLSGHYRPPAANFRAFVKSLKDMGVDMTHVSISK
SYAVLVGLEVYVRTRQKSKRFVQKLIHGKDKIVAPDEVAKRREAEKDNSQSAAREREVLE
REARMRREDKKGVRMLRKLGVQPELDNAADQEPEPRDLVTG
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggctgaggacaaatcatctgagccggtacatgcggacgctgggcgggcggagctcctc
ccgtcccctccaaaaagaccgcgttcagctgcgtgtcaagagtccactgggactaaacca
gaggccaacgactcgtcggaatcgaggcagaaatacctcgaatctttaataccaccatcg
acagaagtgtttaatcggatagcgtgcatccagaaccaccgcgaggatgagatcaggcgc
atgtctcgtgagcacaagcgcccctctactggttcaaaatcacctacccaaccttcacat
gccacgcatagtgccggacggccggctgtcgaggaagcaaccgcggggagccggcctacc
attatcgatgacatcctcctcacgcgtgctgccactctgattcagagaacgtaccgcggc
taccgcacccggaggcagatgtccgggcttaccgtcgatgcagacacgagatgggcgcac
gctttgcgcgaggcacgattccgtgagattaccaaaccacgaccacgatcctggtctggc
gaggcggccgggggtgtcggtgctgctaatccacagaatggtgacgccggcaaacgttcc
actgccgccaggcgaaattggaggaaagcggcgatcgttgcgaggagggctggctgggat
gaggattcgccctcgggttccagctcggatgagtcgattgtgtctttgcggagcaacatg
gacgaagaagagcgcaaggctgccaggaggcggagacaggaatcgagggcgaggatgaaa
aaggcggcccaaaccatggggttgcaatactttctggaaatggtggaccagaagcaccgg
tatggctcgaatctgcggacatatcacgatgagtggaagaagtccaatacccacgagaac
ttcttctactggctagacttcggcgagggaagcaacttggagatggaagcttgtccccgc
gaccggctggaaagggagcaagtccggtaccttagtcgagaggaaaggcaatactacctt
gtcagaatcgacgccgagggacggctgtgctgggcaaagaatggtgccaggatagacact
acagaggattggaaggattcgatccatggcatcgtgcctaaggacgacattaccccagcc
tacagccctgagcttggacagaaagcccgggccccgggccgtagtatcacaggcggcacg
agtagtgggagtgctgattcccgggcgtcggattctgagcttgaggcagcacgagcggcc
aagtatgcgaacccaaccctcgacgaggccaagggcatcaagaaggttagccatgtttcg
gcggccacaatcttcaataagatgctgcgtaaatctgtcaggaagaacacgtggatattc
gttgccgacacatcgttcaggctgtacgtcggtatcaaggattctggtgccttccagcac
tcttcctttctacaaggcggccgaatctcagcggctgggctgatcaagatcaagaatggg
agactcaaatcattgtcacccctcagtgggcattatcgtcctcctgctgccaattttcgc
gcctttgtcaagtctctaaaggacatgggcgtcgacatgacccacgtctcaatcagcaaa
agttatgcggttctcgtgggcctggaggtctacgtgcgcacgaggcaaaagagcaagcgc
tttgttcagaagctgattcacggaaaggacaagattgtcgcaccggatgaggttgctaaa
aggcgcgaggccgagaaggacaacagccaaagtgcggcgcgagagagagaggtgcttgag
cgagaggctaggatgaggcgggaggacaagaagggtgtgcggatgctgagaaaacttggg
gtccagcctgagctcgataatgcagctgaccaggagccagaaccgcgggatcttgttaca
ggataa

DBGET integrated database retrieval system