KEGG   Pyricularia oryzae: MGG_04084
Entry
MGG_04084         CDS       T01027                                 

Definition
(RefSeq) platelet-activating factor acetylhydrolase
  KO
K01062  platelet-activating factor acetylhydrolase [EC:3.1.1.47]
Organism
mgr  Pyricularia oryzae
Pathway
mgr00565  Ether lipid metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    MGG_04084
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     MGG_04084
Motif
Pfam: PAF-AH_p_II Chlorophyllase2 Chlorophyllase Abhydrolase_6
Other DBs
NCBI-GeneID: 2677513
NCBI-ProteinID: XP_003719754
UniProt: G4NGM7
Position
6
AA seq 529 aa
MSSYLGRLNPIPGFPGYSGPHKVGTVDVEIPISELPSPCPVPDGAQDIHTILFRIFYPTS
SEAKGKEITWLPNPQRQYLMGYGFFMGASPLLSSLASFVPRYLHYVTIPAIKNAPLISPA
AKDGRWPTMIFSHGLAGSRNSYSQLAGSLASHGVVVICPEYRDGSAIATVVRDPVALSEY
QGGLFAQRPRSAGVVYRNLPHTPSREISEARDAQLRVRAWETGLLYEALVKIDEGKAESM
TNLNTSTPAEALSRFTNRLDVQEPGKVIWAGHSFGAATITQVVKSTYYADRPQVKSIANP
IFAVKESAKIRQQITNQSVAILLDMWCLPMISPDQTALYKLPLPCYDVNASNSPGGNALL
AVESDAFFKWTEHLHTKAMILSPSPTAVPPVSASAFDEPGFSRPSWFYVKDSAHMSQSDF
AALFPWLVRRVFNGHAPERVVRLNLRAVLQTLRRNGHSVAPTCAADLADGDEPTVAKAAA
AGGLEDDPAILDSKVADLKAIDAWTHIDVVGLGLKSAAAATQTTNVDEK
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtccagttatctgggtcgtctcaacccaatcccgggctttcctggatattcgggacca
cacaaggtcgggacggtggacgtcgagatacccatctcagagcttccatcaccatgccca
gtaccagatggtgcgcaggatatccacactatcctatttcgcatcttctatcctacgagc
tcagaagccaaaggcaaggaaatcacatggctacccaacccccagcggcaatacctgatg
ggatatgggttctttatgggcgcatcccctcttctctcgagtctggcttcttttgttccc
agatatctccactatgtcacaatcccggccatcaagaatgcacctctgatcagtcctgca
gccaaggatggccgctggcctaccatgatcttttctcacggtctggcagggagcagaaac
tcttactcacaactggccggctcacttgccagccatggcgtcgtggtgatatgcccggag
taccgtgacggtagtgccattgctacagttgtcagagaccccgtggctctctcggaatac
cagggaggactgtttgctcagaggccgcggtctgctggggttgtgtatagaaacttgcct
cacacgccatcaagagagatatcggaagctcgcgacgcccagctccgtgtcagagcttgg
gagactggcttattgtacgaggcgctggtcaagatcgacgagggcaaagcagagtccatg
accaatctgaacaccagcacgcctgcagaggctttgtcccgcttcacaaacagattagat
gtccaggagccgggcaaagtcatttgggctggccacagctttggcgctgcaacgataaca
caggttgtcaagtcgacgtactatgcagaccgtccccaggtgaagagcatagccaacccg
atattcgcagtcaaagaatcggccaagatccgccagcaaataacaaaccagtccgtcgcc
attctgctggatatgtggtgtctgcccatgatctccccagaccaaacggcactgtacaaa
ctacccctaccctgctacgacgtcaacgcctcaaactccccagggggcaatgcactgctg
gccgtggagtctgatgctttcttcaaatggaccgagcacctccacaccaaggccatgatt
ctctccccgtccccaacggctgtgcctcccgtatccgcctctgcattcgacgagccggga
ttctccaggccgagctggttttacgtcaaggatagcgcgcacatgagccagtcagacttt
gcggccctctttccctggctcgtgaggcgcgtctttaatggacacgcacccgagcgtgtc
gtgcgacttaatctgcgcgccgtgctgcagaccctccggcggaacgggcattcagtcgcg
cccacctgtgccgctgatcttgctgacggggacgagcctaccgtcgccaaggctgcagca
gcgggtgggctggaagatgatccggcaatcctggatagcaaagttgccgacttgaaggcg
atcgatgcttggactcatattgatgtggtcgggcttggcctgaagagtgcggccgctgcg
actcagaccaccaatgtggatgagaagtag

DBGET integrated database retrieval system