KEGG   Pyricularia oryzae: MGG_04559
Entry
MGG_04559         CDS       T01027                                 

Definition
(RefSeq) exocyst complex component protein
  KO
K19984  exocyst complex component 5
Organism
mgr  Pyricularia oryzae
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgr04131]
    MGG_04559
Membrane trafficking [BR:mgr04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    MGG_04559
SSDB
Motif
Pfam: Sec10 DUF4795
Other DBs
NCBI-GeneID: 2677922
NCBI-ProteinID: XP_003710921
UniProt: G4MRU4
Position
1
AA seq 851 aa
MERASSSGSKALFPKGPSFSLEDFSNKDFIVRDFVDGLAETAVPANRRSGPATQAFDPKP
LIRTFENALSQLSSLSEELQEKESEILSQVRRAENQHDQTLDTLGRKLDQSMDQFEALDL
SLNNPALNGMERSSRSDGGGNIAVQIGEKLEDLDRKRNRALDANFLIQCWQEVTETGQLS
SLQDIQRLGGPDNKVRCAVIARQLMRISQRLDPTSWGQANGIRGNGVTNGTSPTSRRYNT
REVIEKFSETLEQDLLKQFNTSYRKLDHENMMECSRVLWDFNGGASVIALFVNQHQFFID
KDRLVADEVNADSELWDLLADPDAEPPGIESSLQAHLDDVKGTVIDESLLIKRSFPFYET
VMIKFIQRMFQQSIQQRLEQVLEKANTVSSLAFLRSLHASRSYIGTLVEDLKAHGLTEHP
EPCTAAVSQALEQQLDELFVPYLMGNSFIERERKNLEELNSSLLFKFTVYHSRRKKAPSG
FMAAIAQQGSRILESAKDAYMERLDSSELTPTQKAMMLRVAGIQDSDKKNEIEVSESDGL
LSVANAKRMMKWLAESVKRTLELGSSTETPKDVSVLLNLLLSTMGTMYVETALDAALDQT
TSQENSKTEPDLSHLPKIRPGVTITSMMHRFITTVLIRLAEGNTTVRRGMEAQTKVGIEG
IEKKTNSIMKSAMDVIINWTNKSLANNQKKTDFRPKDEGIIDSLQSSTCLGICTFLDRAA
LLASQTIDGHNLEVFSSELALAIHALLFEHFKKFPVNATGGLMVTKDIAKYVSTLKAWPL
TKEVQAVVEILSEVGYLFIIGPEALREKSRGLGSGPGGHGGRKLLKADFKAFVQRRDDAS
SVGIQSVLAGL
NT seq 2556 nt   +upstreamnt  +downstreamnt
atggagagggcgtcgtcctcgggctcaaaagctcttttccccaagggccccagcttcagc
ctcgaggacttttcaaacaaggactttattgtcagggactttgtggatggcctcgccgag
accgccgtccctgccaaccgccgctccggtcctgcaacacaggcgttcgaccccaagcct
ttgatcaggactttcgaaaatgccctgtcgcagctgagctcactctcggaggagttgcag
gaaaaggagtcggagatcctttctcaggtccgccgcgccgaaaatcaacatgaccagacc
ctcgataccctcggtcgaaaactcgaccagtcgatggaccagtttgaggcactcgatctt
tcgcttaacaacccggccctgaatggcatggagcggtcgagcaggtctgatggtggcggc
aatatcgctgtccagattggtgagaagctggaggatctggataggaagcgcaacagggcg
ctggacgccaactttctgatccaatgctggcaagaggtcaccgaaacagggcagctctca
tcccttcaagacatacaaagattgggaggtcccgataacaaggttcgctgcgccgtcatc
gcccggcaattgatgagaatcagccagcggctggatccaacttcttggggccaggccaac
gggattcgcggcaatggggttaccaatggaacgtccccgacaagtcgacgttacaacacc
cgtgaagtgattgagaagttttccgaaactctagaacaagaccttctgaagcagtttaat
acaagttatcggaagctggaccatgagaacatgatggagtgttccagggttctctgggac
ttcaacggcggcgcaagcgttattgctttgttcgtcaatcagcatcaattcttcattgac
aaggatcggcttgtggcggacgaagtcaacgccgacagcgaactgtgggacttacttgcc
gaccctgatgcggagccgccaggcatcgagtccagcctgcaggcacacctcgacgatgtg
aaggggaccgtcatagacgagtcgcttttgatcaagcgatcatttcctttttacgagacg
gtcatgatcaaatttatccagcgcatgtttcagcagtccattcagcaaaggcttgaacag
gtactggaaaaagccaacaccgtatcatcgcttgcatttctgcggtcactgcatgcatcg
cgaagctacatcggcactctagttgaggacctcaaggctcatggcttgacggagcacccc
gagccttgtactgcggccgtgtctcaggccttggaacaacagctggatgagttattcgtc
ccatacctgatgggcaactcgttcatcgaacgagaaagaaagaacttggaagagttgaat
agttcgctgctcttcaagttcacagtctaccactcacgaaggaagaaggcgcctagcggc
ttcatggccgccattgcacagcaaggatcgaggatcctcgagtcggccaaggacgcctac
atggagcgtctggactcgtctgaattgacgccaacacaaaaagctatgatgttgagggtt
gccggcattcaagactcggataagaagaacgagattgaggtctcggaatcagatggactt
ttgagtgtggcaaacgccaaacgtatgatgaagtggctggctgagagtgtcaagaggaca
ctggagctagggtcaagcacagagacgcccaaggacgtcagcgtgctactcaacttactg
ctgagtaccatgggtaccatgtatgtcgagacagcgcttgatgctgcgctagaccagact
acctcgcaggagaacagcaagacagagccagacctctcccacctacccaaaatccggccc
ggggtaaccatcactagcatgatgcatcgctttatcacgacagttttgattcgattggcg
gaaggcaacacgacggtgcggcgaggtatggaggcacagacaaaggtcggcatcgagggt
atcgagaagaagaccaacagtataatgaagagcgccatggatgtgatcatcaactggacg
aacaagtcgttggcaaacaaccagaaaaagacagatttccgccccaaggacgaaggcata
atagacagcctccaatcttcgacctgtctcggtatctgcacctttttggacagagcggcg
ctactggcgagccaaacgatcgacgggcacaatcttgaggtgttcagcagcgaactcgca
ctggctatccacgcactcctgtttgagcactttaaaaagttccctgtcaacgcgacgggc
ggtctcatggtcaccaaggatatcgccaagtatgtgtcaactctcaaggcatggcctctt
accaaggaggtgcaggctgtcgtcgagatcctgtccgaagttggatatctgttcatcatt
ggacccgaggcgctcagggaaaagagcaggggcttggggagtggacctggcggtcacggt
gggcggaaactcctcaaagcagatttcaaggcctttgtccaaaggagagacgacgcgagc
agtgttggcatacagagcgttctcgctggactgtag

DBGET integrated database retrieval system