KEGG   Magnaporthe oryzae: MGG_05785Help
Entry
MGG_05785         CDS       T01027                                 

Definition
(RefSeq) levanase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00052  Galactose metabolism
mgr00500  Starch and sucrose metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MGG_05785
   00500 Starch and sucrose metabolism
    MGG_05785
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MGG_05785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-GeneID: 2684190
NCBI-ProteinID: XP_003712155
UniProt: G4N0X0
Position
3
AA seq 659 aa AA seqDB search
MKFTFVSSALLALVSSAAAQAPPVPQPLTADWLLNKAGNNSLFTRWRPRSHFIAPSGWMN
DPCGAVHDPATDTYHLHYQFHPNHVGWGNVSWGHAVSKDLFHWTDVGGWENDTAVSLAAS
HYKTSPLSVFTGTTQPVNLQGEHDGTLLTFLTGIHRLPTNWKIHYQNGTEVQALFTSKDA
GLTWQEQGIAIPGPPEGWNVTGFRDPSFFPNPDLDAMRNVSEPHYYAVLGSGLKGPDVPA
ELPGAARPGYIGPRMPLYTAPASNLTDWKFLGALWEPAANSSLGNPDVTGSFGYNFEVSG
LFELKANGSDDGAFFVTTGAEGGNTTRHVREQWAVWARGNLSPRANGSIELKPSSGGAVD
WGLSYAQASFVDSRKGNQERRVMWGWANEDIEDDVELAVARTMGYAGAITLPTELFLMET
RGVQKHDYVDGNEWIPDNGAFTAQTLGIRPLPDVIEKLKTGAALNTFDVATVTAGTPKKV
SENVGDSYVLTATLAAPNGTAGIVIAQSPDNSEYTSIVYDAAAKTIGVRRDHSSSLVGIF
SNYTHEGHFAPYKTAGGAAEDIKFTIVYDKSLLEVFVNDRFALTSRIYPVRTDSTALSFF
TGAFGSDKKTDATETTVWKDVKLWMGLAKAWTERPDDSSSPLHWDSAEQTNNYTWWNGW
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcacatttgtgtcatcggcgcttctggcgctcgtctcctccgccgccgctcaa
gcccctccggtgccccagccgttaactgcggactggctgctgaataaggcgggcaacaac
agcttgttcacacgatggaggcctcgctcgcacttcattgcgccctcgggctggatgaac
gacccttgcggtgccgtccacgacccggccaccgacacgtaccaccttcactaccaattc
caccccaaccacgtcggctggggtaacgtttcgtggggccacgccgtttccaaggatctc
ttccactggactgacgtcggggggtgggaaaacgacaccgccgtctcactcgctgcatcc
cactacaagacctcgcccttgtccgtgtttaccggaaccacacagccggtaaaccttcag
ggcgagcacgacggaacccttttgaccttcctgaccggtattcaccgcctgcccaccaac
tggaaaattcactaccaaaatggcaccgaggttcaggctcttttcactagcaaggacgcc
ggcctcacctggcaggagcaaggcatcgcgattcccggccctcccgagggttggaacgtc
acgggcttccgcgacccttcctttttccccaacccggacctggacgccatgcgcaacgtc
tcggaaccacactactacgccgtgctgggctcgggcctcaagggccccgacgtccccgcc
gagctccccggtgccgcccgcccggggtacatcggcccgcgcatgccgctttacacagct
ccggcatccaacctcaccgattggaagtttctcggcgctctctgggaacccgccgccaac
tccagcttgggcaaccccgacgtcacgggctcctttggctacaactttgaggtcagcggc
ctgttcgagctcaaggccaacggcagcgacgacggcgcctttttcgtgaccactggagcc
gagggtggcaacaccacgcgccacgtgcgcgagcagtgggccgtctgggcgcgcggtaac
ctctcgccgcgcgccaacggcagcatcgagctgaagccctcgtccggcggcgccgtggac
tggggtctgtcgtacgcccaggcctcgttcgtcgactcgcgcaagggcaaccaggaaagg
cgggtcatgtggggctgggccaacgaggacatcgaggacgacgtggagctcgccgtcgcc
aggaccatgggctacgccggtgccattaccctgcccacggagctcttcctcatggagact
cggggcgtgcagaagcacgactacgtcgacggcaacgagtggatccccgacaatggcgcc
tttaccgcccagactctggggatcaggccgctgcccgacgttatagagaagctcaagacg
ggcgccgccctcaacacctttgacgtcgccaccgtcacggccggcacgcccaagaaggtc
tcggagaacgtcggcgactcgtacgtcctgaccgcgaccctggccgcccccaacggcacc
gcgggcatcgttatcgctcagagccccgacaactccgagtacaccagcatcgtttacgac
gctgcggccaagacgatcggcgtgcgccgcgaccacagcagctcgctcgtcggcattttt
agcaactacacgcacgagggacactttgccccttacaagaccgcgggcggcgcggccgag
gacatcaagttcaccatcgtctacgacaagtcgctgctcgaggtctttgtcaacgaccgc
ttcgccctcaccagccgcatctacccagtgcgcaccgacagcaccgccctcagcttcttc
accggcgcctttgggtcggacaagaagacggatgcgaccgagacgaccgtctggaaggac
gtcaagctctggatgggactggccaaggcctggaccgagcgccccgacgactcgagctcg
ccgctgcactgggacagtgctgagcagaccaacaactacacctggtggaacggatggtaa

DBGET integrated database retrieval system