KEGG   Pyricularia oryzae: MGG_06021
Entry
MGG_06021         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
  KO
K20372  TBC1 domain family member 20
Organism
mgr  Pyricularia oryzae
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgr04131]
    MGG_06021
Membrane trafficking [BR:mgr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    MGG_06021
SSDB
Motif
Pfam: RabGAP-TBC
Other DBs
NCBI-GeneID: 2683954
NCBI-ProteinID: XP_003711868
UniProt: G4N4U9
Position
3
AA seq 435 aa
MENGSRSSAASLTASGSRESSVKSRRSISSKNSSFRLPINGDDEQILEQDMAKADAISEA
CKFRKINRLKELAVSRGGFLSDRLRRQAWPVLLGLEPESDEVVVDRNVSSSPVDDDGLWK
EMPRHRDEDQVQLDVNRAFIYYPNIEDPIDMEHQKAELSMLIVEVLRTNPYLCYFQGYHD
ICQVFLLVLSPSQRAAIVARLSVLRIRDFMLPNLTPAIAQLRLLPDILQAADPSLCHHLS
QTEPFFALSGTLTMYAHDVQTLGEIARLFDALLAMEPVFSVYVFAAIVMSRRAELFDTPP
DEPEMLHSILSKLPQPLDLDDLLARAVLLAEDHPPETLPNWRRGISPNSVLKTARDSAVC
AKQTLDQGRQFFERQVRELEWDEKREKAMAVLWAYRKPARTIGFAVAFGILAFWLRRSPG
PLTYIASMSNRWLRD
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggagaatgggtccaggtcatcggcggcttccctgacagcttccggatcgcgtgaatcg
tcggtcaaatcaaggaggtcgatttcaagcaagaacagtagctttcgactacccataaac
ggagatgatgaacaaatcctcgagcaggatatggcaaaagcggatgccatctccgaagcg
tgcaagtttcgcaagatcaaccgactcaaagaactggcagtatccagaggaggctttttg
tcggatcgcttgaggcgacaggcatggccggtcctgcttggtctagaacccgaaagcgat
gaggtcgtggtggatagaaatgtgtcttcctccccggttgatgatgatggtttgtggaag
gaaatgcctcggcaccgagacgaagaccaagttcaacttgacgtaaacagggcatttata
tactaccccaacatcgaagatccaatcgacatggagcatcaaaaggcagagctatccatg
ttaattgtcgaggttctccgcaccaacccttacctctgttactttcaaggctatcatgat
atatgtcaagtctttctccttgttctttctccttctcaacgagccgcaatagtcgcacgt
ctctcggtcctgcggatccgggactttatgctacccaacctcacacctgcaatcgcccaa
ctccgcctgttacccgacattcttcaagccgctgacccgtccttgtgtcaccacctctct
cagaccgagcctttcttcgccctatccgggaccctgaccatgtacgcccacgacgtgcag
acgctgggagagattgccaggctcttcgacgcattgttggcgatggagcccgtgttcagc
gtgtacgtcttcgccgcgatagtcatgagccggagggcggagctcttcgacacgccgccc
gacgagcccgagatgctgcactcgatcctctccaagctgccgcaacctctggatctcgat
gacctgctcgcgcgcgccgtgttgctggccgaggaccaccctccagagacgttgccgaac
tggaggcgcggcatctcgcccaacagcgtgctgaagacggcgcgcgactcggctgtgtgc
gcaaagcagactctggatcaaggcaggcagttctttgagcgccaggtccgggagcttgag
tgggatgagaagcgggagaaggcaatggctgtgctttgggcttacaggaagcccgcaagg
accattgggttcgctgttgcttttgggatcttggcgttttggttgcggcgctcaccagga
ccgcttacgtatattgcttccatgtcaaatcgatggctgagggactga

DBGET integrated database retrieval system