KEGG   Pyricularia oryzae 70-15: MGG_06214Help
Entry
MGG_06214         CDS       T01027                                 

Definition
(RefSeq) cytidylyltransferase
  KO
K19785  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
mgr  Pyricularia oryzae 70-15
Pathway
mgr00760  Nicotinate and nicotinamide metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MGG_06214
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     MGG_06214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 2684346
NCBI-ProteinID: XP_003712102
UniProt: G4N0G1
Position
3
AA seq 345 aa AA seqDB search
MHYPSRLARCIMSPNVKVLDFFKEGLENFRLSQDQLEILCEAPRHDAGLPLTQDVICNTT
ISTNRKTDALERSKPRLPRRIIVMDASFNPPTSAHMQMATSAIRSAGDRRNTRLLLLLAV
SNADKAPKPASFEQRLAMMNALAQDVYEEISYDDEAGAAAPESDDNGHRFGIDLALTTLP
YFHDKSAALAAVVETAFEPPPTGRAPVEQVFLIGYDTLIRLFNPKYYSRTENGETVNGIR
EALSPLFGRARARLTLRADADWGGREEQLAYLENVRHGDALEQAGGLKEWASRIDVAETG
DAHGLVSSTSAREAAARGDWVRLRELVPPRVAAWVQDERLYQESE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcactatccgtcccgtctcgcacgttgcataatgtctccgaacgtcaaggtccttgac
ttcttcaaagaagggttagaaaacttccgtttatcccaggaccaactggagatactgtgc
gaagctccgcggcacgacgcgggcttgccattgactcaagatgtaatctgcaatactact
atttccaccaaccgcaagacagacgccctagagagaagcaaaccgcgactgccgaggcgc
atcatcgtcatggacgcctccttcaacccgcccaccagcgcgcacatgcagatggccacg
agcgcaatccgcagcgccggcgacaggcgaaacaccagactgctgctgctgctggccgtc
agcaatgcggacaaggccccgaagccggcctcgtttgagcagcggctggccatgatgaac
gccctggcccaggatgtgtatgaggagatctcgtatgacgacgaggcgggcgctgctgct
cctgaaagcgacgataatggccacaggtttggcatcgatctggcgttgacgacgctcccg
tactttcacgacaagagcgcggccctcgctgcggtggtggagacggcgttcgagccgccc
ccgacggggagagcccccgtggagcaggtgtttctcatcggctacgacaccctgatcagg
ctgttcaacccaaagtactactccaggacagaaaacggagagaccgtgaatggcatccga
gaggcgctgtcgccgttgttcggccgcgcgagggcgcggcttacgctccgcgccgacgcc
gactggggcggcagggaggagcagctggcctacctcgagaacgtcaggcacggggacgct
ctcgagcaggctggcgggttgaaggagtgggcgagtcgcatagacgttgccgagaccggg
gacgcacatggcctcgtcagcagcacgtctgcgagagaagctgccgccagaggggactgg
gtccggctcagggagctggtgcccccgagggtggctgcctgggtccaagacgagaggctt
tatcaagagtctgaataa

DBGET integrated database retrieval system