KEGG   Magnaporthe oryzae: MGG_06289Help
Entry
MGG_06289         CDS       T01027                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MGG_06289
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MGG_06289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 2684444
NCBI-ProteinID: XP_003717298
UniProt: A4R935
Position
4
AA seq 309 aa AA seqDB search
MAPPLSSKVYVDGVYIPAALIVIGTAIVKRDWVVYSVALALALGTWKFFQLKPKKVLDPT
KFQEFELKEKTIISHNVAIYRIQLPSPSSILGLPIGQHISIGADIPQPDGSSKEVVRSYT
PISGDEQPGYVDLLIKSYPTGNISKYMAGLSVGQSIRVRGPKGAFVYQPNMVRHFGMIAG
GTGITPMLQVVRAIVRGRAAGDTTQVDLIFANVTKEDILLKEDLDALAAEDKGFRVHYVL
DRPPEGWTGGVGFVTQDMITKWLPKPADDVKILLCGPPPMVSGLKKATEALGFKKARPVS
KLEDQVFAF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcaccccctctaagttccaaggtttacgtcgacggggtctacatccccgcggcgctc
attgtcatcggcaccgccatcgtcaagagggactgggtcgtctacagtgtcgcccttgct
ttggctctcggcacatggaagttcttccagctcaagcccaaaaaggtccttgacccaaca
aaatttcaggagttcgagctcaaggagaagaccattatatcccacaatgtcgccatctac
cgtatccagctcccatcgccgtcttcgatccttggtcttcccatcggccagcacatctcc
atcggcgccgacatcccccagcccgacggcagcagcaaagaggttgtgcggtcctacacc
ccgatcagcggtgacgagcagcccggctacgtcgacctgctgatcaagtcgtaccccacc
ggtaacatctccaagtacatggccgggctctcggtcggccagagcatccgcgtcaggggc
cccaagggcgcctttgtgtaccagcccaacatggtccgtcacttcggcatgatcgccggc
ggtaccggcatcacccccatgctccaggtcgttcgcgccatcgtccgcggccgtgccgct
ggcgacaccacccaggtcgacctgatctttgccaatgtcaccaaggaggatatcctgctc
aaggaggaccttgatgcgctcgcggccgaggacaagggattcagggtacactacgttttg
gacaggccgcctgagggctggactggtggcgttggctttgttacacaggacatgatcacc
aaatggctccccaagccggcagacgatgtcaagatcctgctgtgcggtcccccgcctatg
gttagcggtctgaagaaggctaccgaggctttgggcttcaagaaggcgcgccccgtgagc
aagcttgaggatcaggtctttgccttctaa

DBGET integrated database retrieval system