KEGG   Pyricularia oryzae: MGG_06327
Entry
MGG_06327         CDS       T01027                                 

Definition
(RefSeq) candidapepsin-3
Organism
mgr  Pyricularia oryzae
SSDB
Motif
Pfam: Asp TAXi_N Asp_protease_2 TAXi_C
Other DBs
NCBI-GeneID: 2684482
NCBI-ProteinID: XP_003717257
UniProt: G4N837
Position
4
AA seq 474 aa
MRLIASLALAASLASSITNGSTIPRRASGTPAAPRVIGLETERQHIPNPLERDRLRRRAA
VMATLDNEQTLYFVNVSIGTPPQKLRLHLDTGSSDLWVNTPDSKLCSVSSQPCRFAGTFS
ANSSSTYQYINSVFNISYVDGSGANGDYVSDMVTVGNTKIDRLQFGIGYTSSSAQGILGV
GYEANEVQVGRAQLKPYRNLPSRMVEEGLIASNAYSLYLNDLQSNKGSILFGGIDTEQYT
GTLQTVPIQPNGGRMAEFLITLTSVSLTSASIGGDKLALAVLLDSGSSLTYLPDDIVKNM
YSAVGAQYDSNEGAAYVPCSLARDQANSLTFSFSGIPIVVPMNELVLDLVTSNGRRPSFR
NGVPACLFGVAPAGKGTNVLGDTFLRSAYVVYDLENNAISLAQTSFNATKSNVKEIGKGS
NPVPGAVAVSQPVAATSGLSQNGGNRSGSGAIARAVPTLLLVGGIFSGSLLTLF
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaggttaatagcatcactggccttggcggcatcactggcctcttcaatcacaaatgga
tcaacgataccgaggagggcctcgggcacaccagctgcgccgagggtaattggcctggag
acggaaaggcagcacatcccgaatcccttggagcgggacaggttaaggaggagagccgcc
gtcatggctactctcgacaacgagcagacgctgtactttgtcaacgtctccatcggcacg
ccaccgcagaagctacgtcttcaccttgacaccggcagcagtgacctgtgggtcaacacg
cccgactcgaaactctgttccgtctcgtcgcagccgtgcagatttgccggaacctttagc
gcaaacagctcctctacatatcaatacatcaacagtgtcttcaacatctcgtacgttgac
ggctcaggcgccaatggcgactatgtctccgatatggtcacggtgggcaacaccaagatc
gaccgcctccagttcggaatcggatacacgagcagttcggcgcagggaattctgggcgtc
ggttatgaggccaacgaggtgcaggtcggacgtgctcagctcaagccgtaccgcaacctc
ccctcgcgcatggtcgaggagggcctgatcgcttccaacgcctacagcctttacctcaat
gacctgcagtccaacaagggcagcatcctgtttggtggcatcgacacggagcagtacacg
ggaacgctgcagaccgtcccgatccagcccaacggtggccgcatggccgagtttctcatc
accttgacctctgtctccttgacctcggcaagcattggcggtgacaagctggccctggcc
gtgctgctcgactcgggttcctcgctcacctacctgcccgacgacatcgtaaagaacatg
tacagcgccgtgggcgcccagtacgacagcaacgagggcgccgcatacgtcccctgctcc
ctcgccagggaccaggccaactcgttgacctttagcttttccggcatccccatcgtcgtg
cccatgaacgagctcgtcttggacctggtaacttccaacggccgccggccctcgttccgc
aacggcgtccccgcctgcctgtttggcgtcgccccggccggcaagggcaccaatgttcta
ggtgacacgttcctccgctccgcctacgtcgtctacgacctcgaaaacaacgccatctcg
ctcgctcagaccagcttcaacgctaccaagagcaacgtcaaggagatcggcaagggcagc
aaccctgttcccggcgccgttgccgtctcgcagcccgtcgctgccacttcgggcctgtcg
cagaacggcggcaacaggtctggctctggcgccatcgcccgggccgttccgactctcttg
ctcgtcggaggaatcttctccggttcgttgttgactctgttctag

DBGET integrated database retrieval system