KEGG   Pyricularia oryzae: MGG_06399
Entry
MGG_06399         CDS       T01027                                 

Definition
(RefSeq) CMGC/DYRK/YAK protein kinase
  KO
K18670  dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
mgr  Pyricularia oryzae
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgr01001]
    MGG_06399
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MGG_06399
Protein kinases [BR:mgr01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   MGG_06399
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1
Other DBs
NCBI-GeneID: 2684554
NCBI-ProteinID: XP_003717171
UniProt: G4N7J5
Position
4
AA seq 1001 aa
MEQWQSPYSDAAGASRRYNSSASNSNSNSNSVGQGHNHLSRDFNGQQQQHLNQQQNQHHQ
HHHQQQQQQHHTPQPPIAFKYDQYPSSQQSQIYHQQQQQHHHNQQQQQQQPHQQQHHHHI
PSLNTATSPIATPQIRDGNGDVAMSDAHDQYSGMKYPMRPHHQAHLSAGARPSNLHSPQE
SSAAAQRYSPMEVMSPTSPYSPYTPKSSSAGGGSHFSSLPPQQRQSPTRGASDYGNSLHS
PYPPQSPYYPSRQSSQSQGHSQSGSQQLPPISSHTGAYDGFSLSATTPTTEALYPPDPKS
PRRVMPPPTYSAPQPVPELKKLRALSDLRPKVSAQPPFRRANPEGGFISPLQALTVHLPA
TYRICNPSFKYESSRNPRRVLTKPSKGTKNDGYDNEDSDYILYVNDILGSEEAGHKNRYL
ILDVLGQGTFGQVVKCQNLKTQEVVAVKVIKNRTAYFNQSMMEVSVLDLLNTKLDKNDDH
HLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLALLNKA
RLIHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSA
IDMWSLGCIVVELFLGLPLFPGSSEYNQVSRIVEMLGNPPNWMLEMGKQSGEFFEKRQDE
FGRRTYQLKSMEQYSKEHGTKEQPSKKYFQANTLPEIIKTYPMPRKNMKQSEIDREMNNR
IAFIDFVRGLLTINPLERWSPQQAKLHPFITQQKYTGPFVPPMNLKSSSLNRSPAPGTQQ
QQQAEALSKQRAQAAQAQANSAVQGAYASMASPAQYQHQPGHPPSAPPVYANNSVYAAGG
SHAPPAPPPYATSQGAYGQMSQSQPPAQMPPANYAGVPPQQGQQQQQHQSQNNMYAQQRS
RPRASTMEQHHQSGIPAAIQRVASHLDPSQPIRLQPSPAYYPPPSDSGALMDNTPGRMGP
NRRGSRAQPGGRGNNKDFIRNLEERTLEEGFMSSSQQGSWN
NT seq 3006 nt   +upstreamnt  +downstreamnt
atggaacagtggcagtcaccatactcggacgctgctggcgcgtctcgacgttacaacagc
agcgccagcaacagcaacagcaacagcaacagcgtcggccagggccacaaccatttgtcg
cgggacttcaatggtcagcaacagcagcacctgaatcaacaacaaaaccaacaccaccaa
caccaccatcaacaacagcagcaacagcaccacacgccacagccgccaatcgcattcaag
tacgatcagtacccgagctcgcaacagtcgcagatttaccatcagcaacaacagcagcat
caccacaaccagcagcaacagcaacagcagccgcaccaacaacaacaccatcatcacatc
ccgagtctcaataccgccacatcgccaattgccacgccgcagataagagacggcaacggc
gacgtcgccatgtcggacgctcacgatcaatactctggaatgaagtatccaatgcggccc
caccaccaagcccacctcagtgccggcgcccgtccctcgaacctgcactccccccaagag
tcgtcggctgccgctcaaaggtattcgcccatggaggtcatgtcgcctacgtcgccgtac
tccccttacacgccaaagtcatcgtcggctggcggcggtagccacttctccagcttgccc
ccgcagcagcgtcagtcgcctacgcgtggtgcttccgactacggaaactccctgcacagc
ccgtaccctcctcagagtccatactacccgagtcgtcagtcatcccagtcccagggtcac
tctcaatcgggctcgcagcaactgccgccaatttcgtcgcacacgggcgcctatgatggc
ttctccctatctgcaaccaccccgacgaccgaggcgctctatcccccggaccccaagtcg
ccgaggcgtgtcatgcccccgcccacatattctgcccctcagcccgttcctgagctcaaa
aagctgcgggccttgtcggatctgcgacccaaagtcagcgcgcaaccacctttccggcga
gccaaccccgagggtgggtttataagccccctgcaagctttgactgttcacctgcctgca
acgtacaggatttgcaaccccagcttcaagtacgagtcctctcgcaacccgcgtcgggtt
cttaccaagcctagcaagggtaccaagaacgacgggtatgataacgaggacagcgattac
atcctctacgtcaatgatatcctcggatctgaggaagctggacacaagaaccgatatctg
atcttagacgtgttgggccaaggaactttcggccaggtggtaaagtgtcagaatctgaag
acgcaggaggttgtagctgtgaaagtgatcaaaaaccgcaccgcctatttcaaccagtcc
atgatggaggtctcagtactcgatctgctcaacacaaaactcgacaagaacgacgatcac
catctcctgcgattaaaagacacattcattcatagacagcatctttgcctagtgtttgag
ctactgagtgtgaatctttatgagctaatcaagcaaaaccagttcagaggccttagtacg
acacttgttcgtgtctttgcacagcaactactcaacggccttgcacttctcaacaaggcg
cgactgatacattgcgatctcaagcccgagaatattttgctgaagaatctcgagagccca
ataatcaagattatcgacttcggctcggcatgcgatgaacggcaaacagtctacacttac
atccagtcacgattctaccggtctcccgaggtcctcttggggctgccgtactcgtctgcc
atcgacatgtggtcgcttggttgtattgtggtggagctgtttcttggtctgccgctcttc
cctggatcatccgaatacaaccaggtatctaggatcgttgagatgctgggcaacccgccc
aactggatgctcgaaatgggcaagcagtctggggagttcttcgagaaacgacaggacgag
ttcgggaggcgaacataccagctgaagagcatggagcagtactcaaaagagcacggcacg
aaggaacaacccagcaaaaaatacttccaggccaacactctgccggaaattatcaaaaca
tacccgatgccacggaagaacatgaagcagagcgagattgacagagaaatgaacaacagg
attgcgttcattgactttgtcagggggctgttgaccatcaatcccttggaaaggtggtct
cctcaacaagcaaagcttcatcctttcatcactcagcagaagtacacagggccctttgtt
ccgcccatgaacctcaagtcaagctccctcaaccgatccccggcacctggaacccaacag
caacaacaggctgaggctcttagcaagcagcgagcccaagccgcacaggcacaagccaat
tccgcggttcaaggagcatatgcatcaatggcttcgccggcgcagtatcagcaccaacct
ggtcacccgccgtcagctccaccagtgtatgccaacaattctgtttacgctgcgggcggc
agtcatgcaccaccagcgcctccaccgtacgcgacctcgcagggtgcgtacggacagatg
tcgcagtctcagccgccggcgcagatgcctccagccaactacgcaggtgttccgccccaa
cagggacagcagcagcagcagcaccagtctcagaataacatgtatgctcagcagaggtcc
cgcccgcgagcgtctaccatggagcaacatcaccagagcggtattcctgcggcgatccaa
agggtggccagccacctggatcccagccagccaattcgactacagcccagcccagcatac
tacccccctccctccgatagcggtgctcttatggacaacactcctggccgtatgggccct
aacagaagaggtagtcgtgcgcaaccaggaggtcgcggcaacaacaaggactttatccgc
aatctagaggagcgcacactcgaagaaggttttatgagcagttctcagcaaggctcttgg
aattga

DBGET integrated database retrieval system