KEGG   Pyricularia oryzae: MGG_08260
Entry
MGG_08260         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
Organism
mgr  Pyricularia oryzae
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 2678598
NCBI-ProteinID: XP_003715826
UniProt: G4MXC0
Position
2
AA seq 308 aa
MVTVHFPMSAMENTVDPAPPSTDAADKVDLLILGAGWTSNFLIPLLEKSGIRFAATSTTG
RSGTIPFRYDPDSSSPEPFRLLPTATTVLITFPLKGQGQSKHLTGLYHSTHQQQTPESTQ
WIQLGSTGIFTDPQWTDESSSYDKTNLRAIAEDELMASVPRATVLNLAGLYDGETRNPRN
WLTRVARTKDAVRGKGALHLIHGADVARAIVAVHERFTPGRRWIIADLRTYDWWDLIQAW
GADARERLVAKGEAGVAEGLDYERWVGELMQEDGIRALPRSQDKLGRVLDSRAFWKEMGT
WPIMGRIE
NT seq 927 nt   +upstreamnt  +downstreamnt
atggtgacggttcattttccaatgtccgccatggaaaacacagtagatcctgccccgccg
tcgacggacgctgcggacaaggtcgatctgctcatcctaggtgcaggctggacgtcaaat
tttttgatccccctgctggaaaagtccggcataagattcgccgcaacgtccacaaccggc
cgttccggaaccatcccgttccgctacgacccagactcgtcctcccccgagccctttcga
ctgctgcccaccgcgacgacagtgctcatcaccttcccactcaagggccaaggccagagc
aaacacctgactggcctctatcacagcacccaccaacagcagaccccggaatcgacgcag
tggatccagctcggctcaacgggcatcttcaccgacccgcagtggacggatgagtcctcg
tcctatgacaaaacgaacctgcgcgccatcgccgaggatgagctgatggcctctgtcccc
cgcgccacagtcctaaaccttgcggggctgtatgacggcgagacacgcaatccgcgcaac
tggctcacccgtgtcgcccgcaccaaggacgcagtcaggggcaagggcgctctgcatctg
atccacggcgccgacgtcgccagggccatcgtcgcagtgcacgagcgattcacgccgggg
aggcgctggatcatagccgacttgaggacgtatgattggtgggatctcatccaggcttgg
ggtgccgatgcgagggagcggctggtggccaagggggaggctggcgttgccgagggtctc
gactacgagcgttgggttggagagctgatgcaggaggatgggattagggctttgccgaga
agtcaagacaagttgggtagggttttggattcgagagcgttttggaaggagatggggact
tggccaatcatggggaggatcgagtga

DBGET integrated database retrieval system