KEGG   Pyricularia oryzae: MGG_08317
Entry
MGG_08317         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
  KO
K12661  L-rhamnonate dehydratase [EC:4.2.1.90]
Organism
mgr  Pyricularia oryzae
Pathway
mgr00051  Fructose and mannose metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MGG_08317
Enzymes [BR:mgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.90  L-rhamnonate dehydratase
     MGG_08317
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N
Other DBs
NCBI-GeneID: 2678616
NCBI-ProteinID: XP_003715758
UniProt: G4MWU7
Position
2
AA seq 438 aa
MTSVKEFPTIKAVRSFVIGGVGSGGDYHNVEGGHWLIDSPISTPCSRWEEYRKSRTSWGI
NVLGSFFVEIEASDGTVGYATGFGGPPACWLTHQHFERFLIGADPRRTNHLFEQMYRASM
FYGRKGLPIAVISVIDLALWDLLGKIRKEPVYQMIGGATKDRLNFYCTGPEPTAAREMGF
WGAKVPLPYCPDEGHVGMKKNIEFLRKHREAVGPDFPLMVDCYMSLNVSYTIELAEKCKD
LDINWWEECLSPDDTDGFEQIKRAHPTLKFTTGEHEYSRFGFRKLVEGRNLDIIQPDVMW
LGGLTELLRVSAMAAAYDIPVVPHASGPYSYHFVMSQPNTPFQEYLANSPDGKSVLPVFG
DLFLDEIIPSKGFLTPKDLDQPGFGLTLNPAARAKMIPGEFWVNPAPLKALTSGAPAEEK
KEGAVEAVVNKVQELTTS
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgacttctgtcaaagagttccccacgatcaaggccgttaggtcttttgtcattggcggt
gtcggctcaggcggtgattaccacaacgttgagggaggacactggctgattgactctcct
atctcaacgccgtgctcaagatgggaggagtacagaaaatctcgaacgagctggggcatc
aacgtcttgggctccttttttgtcgagattgaagcgtcagatggcaccgttggctatgca
actggctttggaggccctcccgcatgctggctcacacaccaacactttgagcgtttcctc
atcggcgccgacccgcgccgtaccaaccacctctttgagcagatgtaccgcgcatccatg
ttctacggccgcaaaggtctccccatcgccgtcatatccgtcatcgacctcgccctgtgg
gatctgctgggcaagatccgcaaggagcccgtctaccagatgatcggcggcgcgaccaag
gaccggctcaacttctactgcacgggtcccgagccgacggcggcacgcgagatgggcttc
tggggcgccaaggtgccgctcccgtactgcccggacgagggccacgttggcatgaagaag
aacattgagttcctccgcaagcaccgcgaggctgtcgggccagacttccccctgatggtg
gactgctacatgagcctgaacgtgtcgtacaccatcgagctggccgagaagtgcaaggac
ctcgacatcaactggtgggaggagtgcttgtcgcccgacgacacggacggcttcgagcag
atcaagcgcgcccaccccacgctcaagttcaccacgggtgagcacgagtactctcgcttc
ggcttccgcaagctcgtcgagggccgcaacctcgacatcatccagcccgacgtcatgtgg
ctcggcggcctgacggagctgctcagggtctcggccatggcggccgcctacgacataccc
gtcgtgccgcacgcctcgggcccctacagctaccactttgtcatgtcgcagcccaacacc
cccttccaggagtacctggccaactcgcccgacggaaagagcgtgctgcccgtgtttggc
gacttgttcctggacgagatcatcccgtccaagggctttttgacccccaaggacctggac
cagccgggcttcggtctgacgctcaaccctgccgccagggccaagatgatccctggcgag
ttctgggtcaacccggcgccgctgaaggcacttaccagtggtgctcccgccgaggagaag
aaggagggtgctgtggaggcggtggtgaacaaggttcaggagcttacgacgtcatga

DBGET integrated database retrieval system