KEGG   Magnaporthe oryzae: MGG_08455Help
Entry
MGG_08455         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00350  Tyrosine metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGG_08455
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     MGG_08455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase OmdA
Motif
Other DBs
NCBI-GeneID: 2678751
NCBI-ProteinID: XP_003715955
UniProt: G4NA86
Position
4
AA seq 386 aa AA seqDB search
MHVDIPSVLAGFACLATAVSGSALPPASSAEKLLTSLQKQAVAALKERGAGANGCTVENA
AVRRDWAKLSKKERKEYIRAVQCLRSAPAKGDPSFAPGAKTRFDDFVAVHINNTLSIHGT
GNFLTWHRYVTWAYENALREECGYKGTQPYWNWFHRADDMTKSPVFDGSDTSLGGNGEFK
AHNGTLGGAGAIFIPPGVGGGCVTKGPFVDFPANIGPVRPGMDGMVPSPTGPLGPNPRCL
TRDLSNVVSRTYFTHANLHNLTLGAASGSIELMQNEFQGRFADGFLGMHGAGHFGVGGDA
SDLFSSITDPSFYMHHSMVDFVYWIWQALHPDLAGDIAGSITVNNSPPSREARKDDLLPM
GVTTQDRPIGDLLDTLGGTPGCYIFE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcgacatccccagcgtcctagcgggatttgcctgccttgcaaccgcggtgtcc
gggtccgctctgcctcccgcgtcttcggcagagaagctcctaacctcgttacagaagcag
gccgtcgcggctttgaaggagaggggagcaggtgcgaacggatgcacagttgaaaatgcc
gctgttaggcgtgattgggcaaagttgagcaagaaggagcggaaggagtacatccgggca
gtgcagtgcctccgcagcgcgccggccaaaggagacccttcctttgcgcccggggccaag
acgcgcttcgacgactttgtggcggtccacatcaacaacaccctgtccatccacggcacg
ggcaactttttgacgtggcatcggtacgtcacctgggcgtacgagaatgcgctccgcgag
gagtgcggctacaaggggacccagccctactggaactggttccaccgcgccgacgacatg
accaagtcgcccgtctttgacggctccgacacctcgctgggcggcaacggcgagttcaag
gcccacaacggcaccctcggcggcgccggcgccatcttcatccctcccggagtgggtggc
ggctgcgtgaccaagggcccgtttgtcgacttccccgccaacatcggccccgtccgcccg
gggatggacggcatggtcccctcgcccacgggaccgctggggccgaacccgcgctgcctg
acgcgggacctgagcaacgtggtctcgcgcacctacttcacccacgcgaacctgcacaac
ctcacgctcggcgccgcgtcgggctccatcgagctgatgcagaacgagttccagggccgg
ttcgccgacgggttcctgggcatgcacggcgccggccactttggcgtggggggcgacgcg
agcgacctcttctcgtccatcaccgacccctccttctacatgcaccactccatggtcgac
tttgtctactggatctggcaggctctgcacccggacctggccggcgacattgccggcagc
atcacggtgaacaacagcccgcccagcagggaggcgaggaaggacgacctgctgcccatg
ggcgtgaccacccaggacaggccgattggcgatcttttggatacgctgggtggcacgccg
ggatgctacatttttgagtag

DBGET integrated database retrieval system