KEGG   Pyricularia oryzae 70-15: MGG_08807Help
Entry
MGG_08807         CDS       T01027                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase prp22
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mgr  Pyricularia oryzae 70-15
Pathway
mgr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MGG_08807
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mgr03041]
    MGG_08807
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MGG_08807
Spliceosome [BR:mgr03041]
 Complex C
  Other components
   Step II factors
    MGG_08807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 T2SSE AAA_30 AAA_19 DUF2075 AAA_14 PhoH AAA_7 ABC_tran AAA_16 SRP54 Myosin_head Herpes_ori_bp
Motif
Other DBs
NCBI-GeneID: 2678973
NCBI-ProteinID: XP_003719164
UniProt: G4NFJ0
Position
6
AA seq 1207 aa AA seqDB search
MDDLENLELLSLVSKVTSELKNHMGVDDKDLADYIIANRLECDGFEAFKKWMDSECEFPP
SLIESIDRLVRSMHPKLRNSSQNADLSAPTTTGRTQEQKNELFKGLAVADTQPALADEGP
DAIDDTLALLEGLAPKGKPEKKDTSRGANGHDDYRKEDRNGERTSYRKRSRSPEAGYGDS
RHRRKEQYRSRSRSRSRGKDQYGRRSRRDKYDDYNDGYDQKPARQDLDDTPVLQKVYDGH
VTGVKDFGAFVNLHGVKGKVDGLVHVSALTDGQRVSHPSDFVDKGQPVKVKVIKIEGSRI
GLSMKEVDQQTGEDLAPEVGFHSGANSMALGSRHNLSNGLLEDKAPDLSAIKNTLPGRKH
KKRMTSPERWEIRQMIASGVAKASDYPELEEDYNNALSGEGQMELEEDVDIEIRDEEPPF
LAGQTKQSLELSPIRVVKAPDGSLNRAAMAGTSLVKERKEIRQQEAEAAAQAAATNGKVD
LASQWEDPMADPDKRKFAADMRRTMQNRPSEAVPEWRQAIAPKNQSFGKRTNMTIKQQRE
SLPVFAFREQLIKAVKENQIMIVVGETGSGKTTQLTQYLAEAGFANEGVIGCTQPRRVAA
MSVAKRVSEEVGCELGQEVGYTIRFEDCTSPATRIKYMTDGMLQREIVIDPDLKRYSVIM
LDEAHERTIATDVLFALLKKATRRRPDLKIIVTSATLDADKFSAYFNECPIFTIPGRTFP
VEILYSKDPESDYLDAALTTVMQIHIDEPPGDILLFLTGQEEIDTSCEILFERMKALGPS
VPELIILPVYSALPNEMQSRIFDPAPPGSRKVVIATNIAETSITIDHIYYVVDPGFVKQN
AYDPKLGMDSLVVTPISQAQANQRAGRAGRTGPGKCFRLYTEAAYQTEMLPTSIPEIQRQ
NLSNTILLLKAMGINDLLHFDFMDPPPINTMLTALEELYALSALDDEGLLTRLGRKMADF
PMEPSLSKVLIASVEMRCSDEMLSIVAMLNLPNVFYRPKEKQTQADAKKAKFHDPNGDHL
TLLNVYNAWKQSRYSKPWCAENFIQFRALTRARDVRNQIERIMQRFKYQVMSCGSDTNRV
RQALCSGFFRNAARKDQQEGYRTLIEGTPVYLHPSSALFGKHAEWVIYHTLVLTTKEYMH
CTTSIEPKWLVDAAPTFFKVSASDKLSKRRQQERIQPLYNKFEGENDWRLSAQRRAGRGG
GGGGTWG
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atggatgatctggaaaatctcgagcttttatcccttgtctccaaggtgacgtcggagctc
aagaaccatatgggagtggatgacaaggaccttgccgactacatcatagccaaccgcctg
gaatgcgacggctttgaggccttcaagaaatggatggacagcgagtgcgagtttccacca
agtttgatcgagagtattgacagactggttcgctcgatgcacccgaagctcagaaacagc
agccaaaacgccgacctgtcagcaccgacgacaacggggcgaacgcaggagcagaagaac
gagctgttcaagggtcttgctgttgccgatacccagccagcccttgccgacgaaggaccc
gatgcgatcgatgatacccttgcgttgctggaaggcctggctcctaaagggaagccggag
aagaaggatacctcgaggggggctaatggtcacgacgactacaggaaggaggaccgaaat
ggagagaggacgtcgtatcggaagcggtctcgaagtccagaggctggttatggggattcg
cgtcacagaaggaaagagcaatacaggtctaggtctaggtctaggtcgagaggaaaggat
cagtacggccggcgcagtcgacgagacaagtacgacgactacaatgacggctacgaccag
aagccagcacgacaggatctggatgatacacccgtgttgcaaaaagtctacgatggacac
gtcacaggagtgaaggactttggtgcttttgtcaacttgcacggtgtcaagggtaaggtt
gacggtttagttcatgtctcggctctaacagatgggcaaagggtcagccatccatcggat
tttgtcgacaagggccagcctgtgaaagtcaaggtcatcaagatcgaaggctcacggatt
ggcctgtccatgaaagaagtcgatcaacaaacgggcgaggacttggcgccagaagtaggg
ttccattccggtgcaaattccatggctcttggttcaaggcacaatcttagcaatgggctg
ctagaagacaaggcgccagatctcagcgccatcaagaacacactacccggcaggaagcac
aagaagcgtatgacttcacctgaacgctgggaaatccgacagatgattgcttcgggtgtt
gccaaggcctccgactacccagaactggaagaggattacaacaatgcgctttcaggcgag
ggtcagatggagctggaggaggatgtggatattgagattcgagacgaggagccaccattt
ttggctggtcagaccaagcaatcccttgagctgtcgccaatcagggtggtcaaggcacct
gacgggtctctcaaccgtgcagccatggcaggcacctcgttggtcaaggagcgaaaggaa
atccggcaacaggaggctgaagccgctgctcaggccgctgccaccaatggaaaggttgat
ttggcctctcaatgggaggatcccatggcagaccccgacaagcgcaagtttgcggccgac
atgcgacgtaccatgcagaaccgtcccagtgaagccgtcccagaatggaggcaagcaatc
gcacccaagaaccagtcttttggcaaacgcaccaacatgaccatcaagcagcaaagagag
tcactgcccgtctttgcattccgtgagcagttgatcaaggccgtcaaggaaaatcagatt
atgatcgttgtcggtgaaacaggatctggaaaaacgactcagttgactcagtatctagcc
gaggccggctttgctaacgagggtgtaattgggtgtacacaacctcgtcgtgtggcagcc
atgtcagtcgcaaagcgtgtgtctgaagaggtcggctgcgagcttgggcaggaggtcggc
tacacgatccgtttcgaagactgcactagccctgccacgagaattaagtacatgacggac
ggtatgcttcagcgtgagattgttatcgaccctgatctgaagcgatattcggtcatcatg
ctagacgaggctcacgagcggaccattgccacggatgttctctttgctctcctaaaaaaa
gccacaaggcgaaggcctgatctcaaaattatcgtcacatcagctacgcttgatgctgac
aagttttcggcctatttcaacgaatgtcccattttcacgatcccgggtcgaacattccct
gtcgaaattctttactcaaaagacccagaatcggattacctcgatgctgcgttgacaacc
gttatgcagatccacattgacgaaccccccggagacatcctgctgttccttacgggtcag
gaagaaattgataccagctgcgagattctatttgaacggatgaaagcattagggccttcg
gtccccgaactaattattttacccgtatattctgcgctccctaacgagatgcagagtcgc
attttcgatcctgcaccacctggcagcagaaaggtcgtcattgcaaccaacattgccgag
acctccattaccatcgaccatatctactacgtcgtcgaccccgggttcgttaagcagaac
gcctacgatcccaagctcggtatggattcgcttgttgttacgcccatttcccaggctcaa
gcaaaccagcgtgccggtcgtgccggacgtaccggtcccggtaaatgcttccgtctctat
accgaagctgcttatcagacagaaatgttaccgacttcaatccctgaaatccaacggcaa
aacttgtccaacaccattttgcttctcaaggccatgggtatcaacgaccttctacacttt
gacttcatggacccgccacccatcaacacaatgttgacagctttggaagagctatacgcc
ctctcggctcttgacgatgaagggcttctcactcgactcggccgcaaaatggctgacttc
cccatggaaccatcactgtccaaagtcttgattgcatcggtagagatgcgttgctccgac
gagatgctcagcatcgtcgccatgctgaacttacccaatgtattttacagaccgaaagag
aagcaaacgcaggcagacgccaaaaaggcaaagtttcacgaccccaatggcgaccacctg
accctgctcaacgtctataatgcttggaagcaaagccgatacagcaaaccctggtgcgcc
gagaactttattcagttccgggcgttgacgcgcgcgcgagatgtgcgaaaccaaatcgaa
agaatcatgcagcgcttcaagtaccaggtgatgtcgtgcggatccgatacgaaccgtgtc
cgacaggcgctatgctccggtttcttccgtaatgcagcacgcaaggaccagcaggaaggt
taccgtacactgatcgagggtacgccggtgtacctgcacccgtcctcggcgctctttgga
aagcacgccgagtgggtcatataccacacgctggtgctaactacgaaggagtacatgcac
tgcacgacaagcatcgagcccaagtggctggtcgacgcagcccctaccttcttcaaggta
agcgcgtccgacaagctgagcaagaggcgacaacaggagaggatccagccgctgtacaac
aaattcgagggcgagaacgactggcggctcagcgcacagcggagggcgggaaggggtggt
ggtggtggtggcacttggggttaa

DBGET integrated database retrieval system