KEGG   Magnaporthe oryzae: MGG_10533Help
Entry
MGG_10533         CDS       T01027                                 

Definition
(RefSeq) agmatinase 1
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00330  Arginine and proline metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MGG_10533
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MGG_10533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 2682152
NCBI-ProteinID: XP_003710150
UniProt: G4MKE9
Position
1
AA seq 423 aa AA seqDB search
MHATVLALGWAATAAARADSASLSVGVTMVHASLLALGWAALASAHDTQKQVPLAGPLES
VWYNTLPGDGGTQADSVFSGITTFGRLPYAPCLKDSSVNYDIAFIGAPFDTGTSYRPGAR
FGPSGIRQGSRRLNLYGGYNVPLAVNPFNSWARVLDCGDIPVTSYDNTWALRQIEEGHHQ
ILSRAPATNANKAGPALRSKTLPRVITLGGDHTITLPLLRSINRAYGPVSVIHFDSHLDT
WKPKVFGGSPSEVASINHGTYFYHASMEGLLHNDTNIHAGIRTTLSGPSDYANDGYCGFE
IVEAREIDTIGTTGIIKRIVERVGTKNPVYLSIDIDTLDPAFAPATGTPETGGWSTRELR
TILRGLEDLNLIAADIVEVAPAYDTNAEHTTMAAADVLYEVMSMMVKKGPLSNMIEEEAI
GDL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgactgtactcgctctcggttgggcagccaccgccgcagctcgcgcagactct
gccagcctctcggtcggcgtcaccatggtccacgcttcgctgctcgccctcggctgggcc
gcacttgccagcgctcacgacacccagaagcaggtccccctggccggtcccctcgagtcc
gtctggtacaacactctgcctggagatggaggcactcaggccgactctgtgtttagcgga
atcacgactttcggccgtctgccttatgcgccgtgcttgaaggactcgagcgtcaactat
gacattgctttcatcggcgccccattcgacactggtacttcgtaccgtcctggtgctcgc
ttcggaccatcgggcatccgtcagggctctcgtcgcctcaacctctacggcggatacaac
gtgcccttggcagtcaaccccttcaacagctgggcaagggtcctggactgcggtgacatt
cccgtgacatcatacgacaacacctgggcgctccgccagattgaggagggccaccaccag
atcctgagccgcgccccggctaccaatgcaaacaaggccggcccggctctgcgctccaag
accctccccagggtcatcaccctcggtggagaccacaccatcaccctgcccctgctgcgc
tccatcaacagggcgtacgggcccgtgtctgtcattcactttgacagccatctcgacacc
tggaagcccaaggtgttcggcggctccccctccgaggtcgcatccatcaaccacggcacc
tacttttaccacgcctcgatggagggcctgctgcacaacgacaccaacatccacgccggc
atccgcacgacgctgagcgggccctcggactacgccaacgacggctactgcggcttcgag
atcgtcgaggcccgcgagatcgacaccatcggcaccaccggcatcatcaagcgcatcgtc
gagagggtcggcaccaagaaccccgtctacttgtccatcgacattgacaccctcgacccg
gcctttgcccccgccaccggcacccccgagacgggtggctggtcgaccagggagctgagg
accatcctgaggggtttggaggacttgaacctgattgctgcggatattgtcgaggttgcg
cctgcctacgacaccaacgccgagcacaccaccatggccgccgccgatgtgctgtacgag
gtcatgagcatgatggtcaagaagggcccgctcagcaacatgattgaggaggaggccatt
ggtgacttgtaa

DBGET integrated database retrieval system