KEGG   Pyricularia oryzae: MGG_10668
Entry
MGG_10668         CDS       T01027                                 

Definition
(RefSeq) ceramide glucosyltransferase
  KO
K00720  ceramide glucosyltransferase [EC:2.4.1.80]
Organism
mgr  Pyricularia oryzae
Pathway
mgr00600  Sphingolipid metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    MGG_10668
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mgr01003]
    MGG_10668
Enzymes [BR:mgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.80  ceramide glucosyltransferase
     MGG_10668
Glycosyltransferases [BR:mgr01003]
 Glycolipid biosynthesis
  Glycosphingolipid
   MGG_10668
SSDB
Motif
Pfam: Glyco_transf_21 Glyco_tranf_2_3 Glycos_transf_2
Other DBs
NCBI-GeneID: 2682281
NCBI-ProteinID: XP_003710106
UniProt: G4MS28
Position
1
AA seq 494 aa
MPLLMDGLAYAGAIWSLIVFCVQAIGLYQLFRSYSRPPPPPVSPSLTSEDVPHVTVIRPV
KGLEPRLYECLISTLQQSYPRDKLSVHLCISSKEDPAYPVLKKVVVEYSATHDVRLFVET
EDPLLYGTTGDTRNLGPNPKIRNISHAYREAKGDIIWIIDCNIWVSKGTAGRMVDKLCGF
PAGSRPYKFVHQLPLSVDVTPPQDSGVLRTGGGRLDEMFMATTHGKFYSAINTVGVAPCI
CGKSNMFRKSHLDRLTDPAHNPILPKETATRPRGIDYFSAYICEDHLIGDLLWRSQVPGH
GNHGLVFGDLALQPMMNNSVGSYIARRVRWLRVRKWTVLLATLVEPGVESMVCCMAFAHA
LTTTPWCPNPADWPIPHTWTALWSIWLAAIAVWATLDYVVYHFLHSCRSIEKDADSPDFA
QGNELMKRPFGAWILAWIGREILALPIWTRAVLLGTTVTWRGTKFKVRPDQSVVDIPNAG
AKSNGIGSTNRKVR
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgccgttgctcatggacgggctggcttatgccggagctatctggtcgcttattgttttt
tgcgtacaggccattggtttatatcaactcttccgctcatattcgcgccctccgccgcca
ccagtatcgccttcactcacatctgaggatgtaccgcacgtaaccgtgatccgcccagtc
aaaggtcttgagccgcggctgtacgaatgcctgatctcgaccctccagcaatcgtaccca
agagacaagctgagcgtgcacctctgcatttcgtccaaagaagacccagcctaccctgtc
ctaaagaaagtcgtggtcgaatacagcgccacacatgacgtccgtctctttgtcgaaacc
gaggatccgttgctctacggcaccactggcgacacacgtaaccttggccccaaccccaag
atccgcaacatcagtcatgcctaccgtgaagccaaaggcgacataatatggatcattgac
tgcaatatatgggtgtctaaaggcacggctggccggatggttgacaagctatgtggcttc
cctgccggctccaggccctacaaattcgttcaccagctcccactgtctgtggacgtcact
ccgcctcaagactccggagtcctgcggaccggcggcggccgccttgatgagatgttcatg
gcaactacacacggcaaattctacagcgccatcaacaccgtcggcgtcgcaccctgcatc
tgcggaaagagcaacatgtttcgcaaatctcatctcgaccgcctcactgaccctgcacac
aatcctatactacctaaagaaacggcgactcgcccacgcgggatagactacttctcggca
tacatctgcgaggaccatctgattggagatttactgtggcgttcgcaggtgccaggccac
ggcaaccacggtctagtatttggcgatctggccttgcagcccatgatgaacaactcggtc
gggtcgtatattgcccgccgggtaaggtggcttcgcgtgcgcaagtggacggttctgctg
gcaaccttggtcgagcctggcgtcgagtctatggtttgctgcatggcgttcgcccacgct
ctaaccaccacgccgtggtgtcccaaccccgccgactggcccatcccgcatacctggact
gccctgtggtccatctggctggctgcaatcgccgtctgggcgacgctggactatgtggtg
taccattttctccactcctgtcgcagcatcgagaaggatgcagactcgccagattttgcc
caaggcaacgagctcatgaagcggccttttggcgcctggattctcgcgtggattggacgt
gaaattttggcactgcctatttggaccagggctgtgttattgggcacgacggtcacatgg
agaggcaccaaattcaaggtaagaccagaccaaagcgtggtcgatattccaaatgcaggg
gccaaatcgaatggaattgggtcgacgaacagaaaggtccgttga

DBGET integrated database retrieval system