KEGG   Pyricularia oryzae: MGG_10832
Entry
MGG_10832         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
  KO
K12947  signal peptidase complex subunit 2 [EC:3.4.-.-]
Organism
mgr  Pyricularia oryzae
Pathway
mgr03060  Protein export
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    MGG_10832
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     MGG_10832
SSDB
Motif
Pfam: SPC25
Other DBs
NCBI-GeneID: 2676347
NCBI-ProteinID: XP_003713432
UniProt: G4MYW4
Position
2
AA seq 232 aa
MAAQEKISVYNAADLKNTSDDAIPNYLNSLKFKQSHTLTDVRLTLGYSAFAISAACFFWD
YKLGFDSTKYYTAAAVALYAILNGALTLWSFFVEKNIVYVGTAPSGEKITIASSVNKYDP
TYRLAITTVPKGASKGQSIEVSRPFAEWFDSVGHFIAAPFQTMLATSVPAIAKVDSKRLA
NIPAAQAETSAPKEDGYSAEMLDAILSSSGSATGADTTGSVSAKKGGKRRKA
NT seq 699 nt   +upstreamnt  +downstreamnt
atggcggctcaagagaagatatcggtctataatgcagctgacctcaagaacacatccgat
gatgccatacccaattacctcaactcgctcaagttcaagcagtcacacacgctcacggat
gtgcgcctgacgcttggctattcggcctttgccatatcggccgcctgtttcttctgggac
tacaagttgggatttgacagcaccaagtactacacggccgccgccgtcgctctatatgcc
atcttgaatggcgctctcaccctctggtctttctttgtcgagaagaacatcgtctacgtt
ggcacagcgccaagcggagaaaagatcaccatagcgtctagcgtcaacaagtacgaccct
acctacaggcttgccatcacaacagtccccaagggcgcttccaagggccagagcatcgag
gtctctcgcccttttgccgagtggtttgactcagttggtcacttcatcgctgcacctttc
cagacgatgctggctacttcagtgccggcgatagccaaggtggattccaaaaggcttgcc
aacatccccgccgctcaggcagagacctcggcacccaaggaagatggttacagtgccgag
atgttggacgctattttgtcctcgtccggatcagctacaggtgcagacaccaccggctca
gtatcagccaagaagggtggaaagcgccgcaaggcttga

DBGET integrated database retrieval system