KEGG   Pyricularia oryzae: MGG_11167
Entry
MGG_11167         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
  KO
K02183  calmodulin
Organism
mgr  Pyricularia oryzae
Pathway
mgr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    MGG_11167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgr01009]
    MGG_11167
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgr04131]
    MGG_11167
   03036 Chromosome and associated proteins [BR:mgr03036]
    MGG_11167
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgr04147]
    MGG_11167
Protein phosphatases and associated proteins [BR:mgr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     MGG_11167
Membrane trafficking [BR:mgr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    MGG_11167
Chromosome and associated proteins [BR:mgr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     MGG_11167
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MGG_11167
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_9 SPARC_Ca_bdg EF-hand_4 RuvA_C SurA_N_3 EF-hand_14 DUF2004 YflT DUF5580 Flu_M1_C Dimerisation Smg4_UPF3
Other DBs
NCBI-GeneID: 5051139
NCBI-ProteinID: XP_003714676
UniProt: G4MUT9
Position
2
AA seq 161 aa
MPAQTLSNDQLKQLKDVFDLIDKDGTGAISASEFAEAMESLGLSSSAAEAQEIISEIDQN
KDGQIDFHEFLRVMSHPETHDALSPNERSKDSKKDERELLAAFKVFDSDGSGSISPEELR
HALRPLGYTPAEIDEMIAHADLDGNGSIDYQEFVELMSQKH
NT seq 486 nt   +upstreamnt  +downstreamnt
atgccagcccaaactctctccaatgaccaactcaagcaacttaaagatgtttttgacctg
atcgacaaggatggaaccggtgccatctcagcctccgaattcgccgaggccatggagtcc
ctcggtttgagctcctcggccgccgaggcgcaggaaattatcagcgagatagaccagaac
aaggacggccagatcgactttcacgagtttcttcgggtcatgtcgcatcccgagacacac
gatgccctgagccccaacgagaggagtaaggactccaaaaaggacgagcgtgagctgctc
gctgccttcaaggtctttgattcggacggcagcgggtccatctcccccgaggagctgcgc
catgccctgcggcccctaggttataccccggctgagatcgacgaaatgattgcccatgcc
gacctggatgggaacgggtcgatcgactaccaagaatttgtggagctcatgtcgcagaag
cattag

DBGET integrated database retrieval system