KEGG   Pyricularia oryzae: MGG_12309
Entry
MGG_12309         CDS       T01027                                 

Definition
(RefSeq) hypothetical protein
  KO
K16572  gamma-tubulin complex component 5
Organism
mgr  Pyricularia oryzae
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgr03036]
    MGG_12309
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mgr04812]
    MGG_12309
Chromosome and associated proteins [BR:mgr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     MGG_12309
Cytoskeleton proteins [BR:mgr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     MGG_12309
SSDB
Motif
Pfam: GCP_N_terminal GCP_C_terminal GCP5-Mod21
Other DBs
NCBI-GeneID: 5050910
NCBI-ProteinID: XP_003715157
UniProt: G4MZ77
Position
2
AA seq 928 aa
MAFAALLGAQVEELIEAICPDAYESQRRRVVSLREECLKKLRHHTFTRTNQFLVEEELNG
LQEKFVVNGRDGLAAALETRRDNLEPLSTKWTPDILHLLLELSDQPLQQSHLADLHLLRR
SDLDAGPTLKWEDIANEDGWVHDRALWRNVDFGAGSSEDESYEEHAVTSGSSDSEDTSIS
DTTPQLKIPQDLSSTGPSSINLDDVKESQSWRLESPCPGDEGRRSKIPITEAQVVREILF
MLQGHKTSLFDEKCAPVLAYQLSEVSWETYRALITAVAEIGRPLQPLRGFVESRQDVPLL
QTFQDCIREALGAFDREIAGMQARYADPKMDVMVSVMAVMEEAQIHLASLRSLGAIVQRL
RDERYPHAFRYLELLFEATCASQLQGDLTAYKTLGSTFLKCFQVYLRPIRLWMEEGELLP
GDKIFFISESKVKLPLNQIWQNQFKLRQTLDGRLHAPRFLQFAVARIYTTGKSIVVLKHL
GMNDLAASHQQSRQPPSLEFADVCPPGSELAPFSELFANVFDAWIKSKHHATSSVLQKAL
FESCGLRSTLGALQHLYLMKDGAASDYFTSAVFDKMDKRQSGWDDRFMLTELAQEAFSGL
LDVHRVSASFDKSAGARSEMTEGRIPIRENLPRLKLRYRMAWPVQLVIKGDCLERYQGIF
TILLQLRRSIHALNMNRLLLDGRTEECMLRAESNAYYRLRTRLLWFCNTVMTYLTTLVFT
PNIEALKETLSSAEDVDGMIHRHAAFVATVIQESCLGPRLDPIRECMLDVLDLAVELEDS
RNLAAIMEATESHEIMRLSTMSSPHRAHTLSPADFRKSQLRGLYVSPKEKEEDHDEVDVE
RGDLDDQDDHRASNMAPLSGRGTGRARETAPQRRDTYPATLRRISADFDRHLRFIAGGLR
GVARASSESAAGKWDILAEMLEAGISSM
NT seq 2787 nt   +upstreamnt  +downstreamnt
atggcgtttgccgcactgttaggggcccaggttgaagagctcatagaagccatatgtcct
gatgcttatgagtcacaaaggagacgggtcgtttccctccgcgaagaatgtctcaagaaa
ctccgtcaccacaccttcactcggacaaaccagtttttggttgaggaagaactgaacgga
cttcaagagaagtttgtcgtaaatgggcgtgatgggctcgcagctgccttggagacccgc
cgggacaatcttgagcctctctcgactaaatggacgcctgatatccttcacctgttgctg
gagctgtcagatcaaccccttcagcaatcccacttggccgatcttcatttgctgagaaga
tcagacctcgacgctggcccgactctgaaatgggaggacattgccaatgaggatggctgg
gtccatgaccgagctttgtggaggaatgtcgactttggtgcgggaagctccgaggatgag
tcgtacgaagaacatgcagtcaccagtggctcctccgactcggaagacacatccatctca
gataccacccctcaactcaagattcctcaagacttgagctcgaccgggccaagctcgatc
aacctagacgacgtgaaagagtctcagtcctggcgtttggaatcaccttgccctggcgat
gagggacgtagaagcaaaataccaataactgaggcacaggtagtcagggaaatactgttc
atgttgcagggtcacaaaacctcactttttgacgaaaaatgcgcccccgtgctagcatat
cagctgtcagaggtctcatgggagacgtaccgtgctttgatcacagccgtcgcagaaata
ggacgcccactgcaaccgcttcgaggttttgtcgaaagccgacaagacgtaccgttgctc
cagactttccaggattgcattcgggaagccctcggagcattcgacagagagatcgccggc
atgcaagctcgctatgccgatccaaaaatggacgtcatggtcagcgtcatggcagttatg
gaagaggctcagatccacctggcttcgttgcgatcgcttggggccattgtgcaaaggctt
cgggatgaacgctacccccatgcatttcggtacttggagcttttgttcgaggctacatgc
gcgtcacaattgcagggcgatctgactgcctacaaaacactggggtctacttttctcaaa
tgctttcaggtttatctgcgccctatcaggctatggatggaggaaggagagctcctgcct
ggtgacaagatattctttatctccgaatccaaggtcaaactgcctttgaaccagatctgg
cagaaccagttcaagcttcgccagactctggacggacggttacatgcaccaagattcctc
cagtttgcagtggcgcggatatacacgactggcaaaagcatcgtagtcttgaagcatctg
ggaatgaacgacttggcagcgagccaccagcagagccgacaaccccctagcctcgaattt
gccgatgtctgcccccctgggtctgaactcgccccgttctcggagctctttgccaatgtg
tttgatgcatggattaaaagcaagcaccatgcgacatcctctgtgctccaaaaggctctg
tttgagtcttgcggcttgcgatctacgctgggtgcccttcagcacttgtatctcatgaag
gatggtgccgcttccgactattttacctcggctgtatttgataagatggacaaaagacag
tcaggctgggacgatcgcttcatgctgacagagcttgctcaggaggctttctctgggttg
ctggatgtgcatcgcgtgtcggcatcttttgacaagtcagcgggcgctcgttccgaaatg
accgaaggtcggattcctattcgcgagaacctacctaggctcaagcttcggtatcgcatg
gcctggccggttcagctggtaatcaagggcgactgtctcgagaggtaccaaggcatcttt
acaatcttattgcagttgcggcgttcgatacatgcactgaacatgaaccggttgctactg
gatggaaggaccgaggaatgcatgcttcgtgcagagtccaatgcatactaccgtctgcga
acgagactgctgtggttctgcaacactgtgatgacatacctcacgactctggttttcacg
ccaaacatcgaagcgctgaaggagacactgagttcggcagaggatgtcgatggcatgatt
catcgccacgcggcattcgtcgccacggtgatccaggagtcatgtctgggaccgcgacta
gaccccataagggaatgcatgctagacgtactagatctagctgtggaactggaagattcg
cgcaacctcgccgccatcatggaagcaaccgagtcgcacgagatcatgcgactctcaacc
atgtcatcaccacacagagcacacacgctgtcaccggctgactttcggaaatcgcagctc
agggggctttatgtgagccccaaggagaaggaggaggatcacgacgaagtagacgtagag
aggggtgacctcgatgaccaagatgatcatcgagcctcgaacatggcccctctttccgga
agaggcacgggaagagcgcgtgagacagccccgcagaggcgcgatacatacccggcaacg
ctcaggcgaatctcggccgactttgataggcacctcaggttcattgctggcgggctcagg
ggcgtcgctcgtgcgagcagtgaatcagctgctggcaagtgggacatacttgccgagatg
ctagaggccggaatctcttctatgtag

DBGET integrated database retrieval system