KEGG   Pyricularia oryzae: MGG_12868
Entry
MGG_12868         CDS       T01027                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mgr  Pyricularia oryzae
Pathway
mgr00062  Fatty acid elongation
mgr00071  Fatty acid degradation
mgr00280  Valine, leucine and isoleucine degradation
mgr00310  Lysine degradation
mgr00380  Tryptophan metabolism
mgr00410  beta-Alanine metabolism
mgr00640  Propanoate metabolism
mgr00650  Butanoate metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01200  Carbon metabolism
mgr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MGG_12868
   00650 Butanoate metabolism
    MGG_12868
  09103 Lipid metabolism
   00062 Fatty acid elongation
    MGG_12868
   00071 Fatty acid degradation
    MGG_12868
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGG_12868
   00310 Lysine degradation
    MGG_12868
   00380 Tryptophan metabolism
    MGG_12868
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MGG_12868
Enzymes [BR:mgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MGG_12868
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 5050236
NCBI-ProteinID: XP_003717318
UniProt: G4N8F1
Position
4
AA seq 291 aa
MNAFRALRPVASKIQAPTLPRITRGFAASSRLGYEHIQVSEPRPGVGQVTLNRPKALNAL
STPLIKELNTALGDYQKSDSISVIVITGSQKAFAAGADIKEMAPLTFSKAYTESFIENWS
DLTTQVKKPIIAAVSGHALGGGCELALMCDFIYCTESANFGQPEIKLGVIPGAGGSQRLT
KAVGKARAMELILTGKSMTGAEAARWGVAARSFATYEELMEATLKTAETIASYSKVAVQA
CKEVVNKSQDLGLRDGVEYERRVFHSLFGSQDQKIGMTAFAEKKKPEWTHQ
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaacgccttcagagctcttcggccagtcgcctcaaaaatacaggcacctaccctgccg
cgaatcaccaggggatttgcagcttcttccaggctgggatatgagcacattcaggtctcg
gagcccaggccaggtgttggtcaagtcacgctcaacaggccaaaggcgctcaacgccctc
agcaccccactgatcaaggagcttaatacggcgctgggcgactaccaaaagtcagatagc
atatcggttattgtaatcacgggctctcagaaggccttcgcagcaggtgccgacatcaag
gagatggcacctctgacattctccaaggcctacaccgagtcattcatcgagaactggtca
gacctgaccactcaggtcaaaaagcccatcattgcagccgtttccggtcacgcgcttggt
ggcggctgcgagctggcccttatgtgcgactttatctactgcaccgaatcggccaacttt
ggccagcctgagatcaaactgggcgtcattcccggcgccggcggcagtcagcgcctcacc
aaggcagttggaaaggctcgtgccatggagctgatcctcacgggcaagtccatgactggc
gctgaggccgcacggtggggtgttgctgccaggtcgtttgcgacgtacgaggagctgatg
gaggccacgctcaagacggccgagacgatcgcaagctactcaaaggtcgctgtccaggcg
tgcaaagaggttgtcaacaagagccaggatctggggctgcgcgacggcgtggaatatgag
cgtagggtgttccacagtctgtttggaagccaggaccagaagattgggatgacggctttt
gcggagaagaagaagcccgaatggactcatcagtaa

DBGET integrated database retrieval system