KEGG   Magnaporthe oryzae: MGG_13806Help
Entry
MGG_13806         CDS       T01027                                 

Definition
(RefSeq) 14-3-3 family protein
  KO
K06630  14-3-3 protein epsilon
Organism
mgr  Magnaporthe oryzae
Pathway
mgr04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    MGG_13806
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgr03400]
    MGG_13806
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgr04147]
    MGG_13806
DNA repair and recombination proteins [BR:mgr03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    MGG_13806
Exosome [BR:mgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MGG_13806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3
Motif
Other DBs
NCBI-GeneID: 5049025
NCBI-ProteinID: XP_003710925
UniProt: G4MRU8
Position
1
AA seq 278 aa AA seqDB search
MATERESKTFLARLCEQAERYDEMVTYMKEVAKLGGELTVDERNLLSVAYKNVVGTRRAS
WRIISSIEQKEESKGSDKHVSTIRDYRNKIEAELEKVCQDVLDVLDESLIPNAASGESKV
FYHKMKGDYHRYLAEFASGEKRKTAATAAHEAYKSATDVAQTELTPTHPIRLGLALNFSV
FYYEILNSPDRACHLAKQAFDDAIAELDSLSEESYRDSTLIMQLLRDNLTLWTSSETGEG
ETAAAGATDAPKEEAKTDAPAAEKTEAKADEPAAAPAS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgagcgcgaaagcaagaccttcctcgccaggctctgcgagcaggccgagcgc
tacgatgagatggttacgtacatgaaggaggttgccaagcttggtggtgagcttaccgtc
gacgagcgcaacctgctctcggttgcctacaagaacgtcgtcggcacccgccgcgccagc
tggcgcatcatctcctcgatcgagcagaaggaggagtccaagggctcagacaagcacgtg
tccaccatccgtgactaccgcaacaagatcgaggccgagctcgagaaggtctgccaggat
gtcctcgatgtccttgacgagtcgctcattcccaacgccgcctcgggcgagtccaaggtt
ttctaccacaagatgaagggtgactaccaccgttacctcgccgagtttgcctcgggtgag
aagcgcaagaccgctgccaccgctgcccacgaggcctacaagagcgctaccgatgttgcc
cagaccgagcttacccccactcaccccatccgtctgggtctggcccttaacttctccgtc
ttctactatgagatcctgaactcgcccgaccgtgcttgccacctggccaagcaggcattt
gacgatgccattgccgagctcgactctctgtctgaggagtcataccgcgacagcaccctt
atcatgcagctgctccgcgacaacctgaccctgtggacctcgtctgagacgggtgagggt
gagaccgccgccgccggtgctaccgatgcccccaaggaggaggccaagacggatgcgccc
gctgctgagaagactgaggccaaggctgacgagcccgccgccgcccccgcttcgtaa

DBGET integrated database retrieval system