KEGG   Pyricularia oryzae: MGG_13986
Entry
MGG_13986         CDS       T01027                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mgr  Pyricularia oryzae
Pathway
mgr00100  Steroid biosynthesis
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MGG_13986
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MGG_13986
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 2678847
NCBI-ProteinID: XP_003716043
UniProt: G4N5U8
Position
4
AA seq 480 aa
MALAVRTKYEFFGPPGATAIVFGLPVLLWTLFFGCNDVSGCPAPALLSPRDLTWAKLKSE
IPWPENGVRGFVSWEVTFWTFAYYFLSLVLHRVMPAQEVVGTKLRDSGRPLTYRFNAFNA
SVVQLIACAFGTYLQGADFVVWKFMTDNYLQLLTTNILLAYAISIWVYAKSFSVKPGNPE
LRELAQGGHTGNVIYDFYIGRELNPRVTWPFFGEIDVKTFLEMRPGLTGWILLNCANIAK
QYRNYGFVSDSILFTTAVQAYYVLEGQYMETGILTMMDITTDGLGFMLTFGDIAWLPFLY
STQTRYLSTYPVTLGPAGLAIVSAVFATGLYIFRSSNSQKNLFRRDPNHPSVKNLSYIQT
KRGTRLLTAGWWGMSRHINYFGDWLQASPFSLPTGIAGYMILPAGSAVAEAGATMVDGRQ
VIQGAARGWGMLFTYLYVVYFAVLLIHREGRDDVACSEKYGEDWEKYKKAVKYKILPYVY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggctttagcagtcagaaccaagtacgagttctttggacctcccggcgcgaccgccatc
gtcttcggtctcccggtgcttttgtggaccttgttctttggctgcaatgacgtctcgggt
tgcccggcgccggcgctgctgagtccccgcgacctcacgtgggccaagctcaagtccgag
attccgtggcccgagaatggcgtccgtggctttgtcagctgggaggttaccttttggacg
tttgcctactacttcctgagccttgtcctccaccgtgtcatgccggcgcaggaggtggtc
gggaccaagttgagggattcgggtcgtcccctcacctaccgattcaatgccttcaatgcc
tctgtcgttcaactcattgcctgcgctttcggaacgtacctccaaggcgccgactttgtt
gtttggaagttcatgaccgacaactacctgcagctgttgacaaccaacatcctcctggct
tacgccatctccatttgggtctacgcaaagagcttctctgtcaagcccggcaaccccgaa
ctgcgcgagcttgcccagggtggccacactggcaacgtgatctacgacttctacatcggc
cgtgagctcaaccctcgcgtcacgtggccctttttcggcgagatcgatgtcaagaccttc
ctcgagatgcgcccaggcttgacgggctggatcctgctcaactgcgccaacattgccaag
cagtaccgcaactatggttttgtttccgacagcatcctgttcacgacagctgtgcaggct
tactacgtgctcgaaggccagtacatggagacgggtatcctgaccatgatggacattact
accgacggcctgggctttatgcttacttttggcgatatcgcatggctgcccttcctttac
tccacgcagacccgctacctgtccacgtacccagtcacactcggtcccgcaggtctggcc
atcgtcagcgccgtgttcgccaccggtctgtacatcttccgctcttccaactcgcaaaag
aaccttttccgtcgggaccccaaccaccctagcgtcaagaacctgtcatacatccagacc
aagcgcggtactcgcctgctcaccgctggctggtggggcatgtctcgccacatcaactac
tttggcgattggctgcaggcgtcacccttcagcctgccgaccggtatcgccggttacatg
atcctccctgccggcagcgccgtcgccgaggccggcgcgaccatggttgacggccgccag
gtcatccagggcgcagcccgcggctggggtatgctctttacctacctttacgtcgtctac
tttgcggtcctgcttatccaccgcgagggccgggacgatgtggcctgctccgagaagtat
ggcgaggactgggagaagtacaagaaggctgtcaagtacaagatcctgccgtacgtgtac
tag

DBGET integrated database retrieval system