KEGG   Pyricularia oryzae 70-15: MGG_15167Help
Entry
MGG_15167         CDS       T01027                                 

Definition
(RefSeq) succinyl-CoA ligase subunit alpha
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mgr  Pyricularia oryzae 70-15
Pathway
mgr00020  Citrate cycle (TCA cycle)
mgr00640  Propanoate metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01130  Biosynthesis of antibiotics
mgr01200  Carbon metabolism
Module
mgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MGG_15167
   00640 Propanoate metabolism
    MGG_15167
Enzymes [BR:mgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MGG_15167
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MGG_15167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 12986400
NCBI-ProteinID: XP_003710653
UniProt: G4MPJ8
Position
1
AA seq 733 aa AA seqDB search
MSALARAAACRRPQTPSAFPLLLPTQHRPLHTSSSSTSPPPRPPTAYSQTTSNLLIGAHT
RVLYQGFTGRQATANAAASIAWGTNVVGGVSPGRSGTHETLGLPVLGSVREAAAALRPDA
TAIFVAADQTAAAIEEAVQAEIGLVVAVAEHVPMRDMLRVHDVLRTQSRTRLVGANSPGI
VAPRGRCRVGFQPLGVFSPGKVGIAAKSGTLSYEVAASTTRAGLGQSLCVGVGGDVLAGT
DMCEALGVLLRDDATEAVALVGELGGVGELEAAELIREYRRSGGRKPIVALLAGLGVESE
RVIGHAGAFWEKRTELARTKQRALEDIGVSLVTHPSEMGEVIKRKLQNDSKHMSDQDQQS
RGEFLWTGFDADKGAVTQGQIDPAMVENRLEHSLQRNDISYQWDSSTSCHGITIDVDRSD
RRLVAMVEKPGVRTRPVGVRHSSSIHDDDNAVALLTQELGDLRPSSSQKGGSLAPMPAQD
TTQRLVRAMTELMHDPFLNTFRATLHIDQHALNNTGELLVRGYSLKPVPVVPAAPNSRCQ
IRDPVEAEAATHGITHFSLPTEPHQRRCIGVLSNGAGLAMNMIDALHAELGRRRVAAGGR
GAEEDVAVANFLDTGGKATSETISRCLGWILRDERVRVVFVNIFGGIIRGDVIAEGLIMA
LKEMRQGGAVCGQGTGRAAVPLVVRIRGTREKEGQALLAESGLDGVYVFDDFHRAADMAV
ELAKDARIDDSKL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctttggcccgtgccgccgcatgtcggcgaccccaaacaccatcagcctttccc
cttctcctccccacccagcaccgcccgctacacaccagcagcagcagcacatcaccccca
ccccggcccccgaccgcctactcccaaacgacctccaatctgctgatcggcgcccacacc
cgcgtcctctaccagggcttcacgggccggcaggccaccgccaacgccgccgcctccatc
gcctggggcaccaacgtggtcggcggcgtatcccccggccggtccggcacgcacgagacg
ctgggcctgcccgtgcttggcagcgtgcgcgaggcggccgcggctttgcggcccgacgcc
accgccatctttgtcgcggcggaccagaccgccgccgcgatcgaggaggccgtccaggca
gaaattgggctggtcgttgcggttgccgagcacgtgccgatgcgggatatgctccgcgtg
catgatgtgctgcgcacccagagcaggaccaggctggtcggcgccaactcgccgggtatc
gtggcgccgcgcggcaggtgcagggttgggttccagccgcttggggtgtttagtcccggc
aaggtgggcatcgcggcaaagtcggggacgctgagctacgaggtcgcggccagcacgacg
agggcgggcctggggcagagcctgtgcgtcggtgtcgggggtgatgtgctggctggcacg
gacatgtgcgaggcgctgggtgtgctgttgcgcgatgatgcgaccgaggcggttgctttg
gtgggggagctgggtggcgtcggtgagctggaggctgccgagctgattagggaatatcgg
cggagtggtggacgaaagcccattgtggctttgctggcaggactgggcgtggaaagcgag
agagtgattggtcatgccggcgcgttctgggaaaagaggacagaattggcaaggaccaag
cagagggcgctggaggatatcggcgtcagtttggttacgcacccttccgagatgggcgag
gtcatcaaacgaaagctccagaatgactcgaaacacatgtctgaccaagaccaacagtca
cggggcgagtttctctggacagggtttgatgccgataaaggcgccgtcactcaggggcaa
attgacccagccatggtcgagaacaggcttgaacatagcctgcagagaaatgatatatca
tatcagtgggattcgtcgacatcgtgccacggaattaccatcgatgtcgaccgatcagat
agacgccttgttgccatggtcgagaagccgggtgtgcgcacaagaccggtcggcgtccga
cacagctccagcatacatgacgacgataacgctgtagctctcctcacccaagagcttgga
gacttgaggcccagctcaagtcagaaaggaggctccctggcacctatgccggcacaggat
accacgcaacggcttgtgagggccatgacggagctgatgcacgatcctttcctgaacaca
ttcagagccacattgcatatagaccagcacgcattaaacaacacgggagagctgctggtg
cgcggctacagcctaaagcctgtccccgtggtgcccgccgcgcccaactcgagatgccag
atcagggaccccgttgaggccgaggcggccacgcacgggataacacacttttccctcccg
acggaaccccaccagaggaggtgcatcggggtgctgagcaacggcgcgggcctggccatg
aacatgatcgacgcgctgcacgccgagctggggaggaggagggttgcagcagggggtagg
ggcgcggaggaggacgttgccgtggccaacttcctggacacgggcggaaaggcgaccagc
gagaccatcagccggtgcttgggctggattctgcgggacgagagggtcagggtggttttt
gtaaacatatttggcggcataatcaggggggatgtcattgccgaggggctcatcatggcg
ctgaaggagatgcgtcaagggggagcggtgtgcggtcaaggcactggcagagcggctgtg
cctctagttgtgcggatcagaggcacgcgggagaaggaaggacaggcattgcttgctgag
agcgggctggatggggtttatgtgtttgatgactttcacagagcggctgacatggctgtt
gagctggcgaaggacgcaagaatagatgactctaagctgtaa

DBGET integrated database retrieval system