KEGG   Pyricularia oryzae 70-15: MGG_16895Help
Entry
MGG_16895         CDS       T01027                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
mgr  Pyricularia oryzae 70-15
Pathway
mgr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    MGG_16895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mgr03012]
    MGG_16895
Translation factors [BR:mgr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    MGG_16895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 12985729
NCBI-ProteinID: XP_003712797
UniProt: A4QSX4
Position
3
AA seq 865 aa AA seqDB search
MSRFFRGGNESSSESSSDEEELYSEEEEEELEDEGDDSDNDGSGDDDSDSDSDADAGGKK
KGAAKFLVDDDSSDEEDSDAEVTTKVKSAKDKRLDELESTVTAIANGMKINDWGSIATEF
DKLNRQAEKLRTGTTAPKMYIKSIADLEDFMNETLAKQKVTPKKMNATNARGLNAVKQRI
KKNNKEYQAQIDAYKADEFEFMMDTEDEEEPAPKPKKAAKVSFDEATAEDEEDDEGFARV
GKGGKTLQFTPESIFKHLRSILESRGKKNTDRGEQIKIMEKLGEIAQTPYQRIRVLLALV
SSRFDIGTSAGAALSVEHWKAAEKELSLLLTVLDENKDHIVLESAEEWDDDEKPPTLEKG
EKYIKIPGSIVSYTERLDDELTRSLQAIDPHTSEYIDRLSDEGALYNIIFRAQLYYEGLR
KDASLEIPQESLNRAIMRRLDHVYFKPAQVIKILEENSWKAVGDKASNITPREQTVEAAQ
LVNVLCNYLFANSEGIHRARAMLCQIYFLALHDDYYKSRDMMLMSHLQETISSFDVLTQI
LYNRTLVQVGLCAFRKGLVYDAQNTLQDICGSGRQKELLAQGVMIQRFNQVSPEQERLER
QRQLPFHMHINLELLECVYLTCSMLLEIPLLAQTGSSPDIKKRIISKTYRRMLEYHERQI
FTGPPENTRDHVMQASKALAAGEWKKATSFIHSIKIWELMPNADAIKTMLAKQIQEEGLR
TYLFTYAPFYDTLSIETLSNMFELESTKISAVVSKMISHEELAAALDQVKQTVIFRKGVE
LSRLQSLALTLSDKASSLIESNERTLEQRTQGTSNAFERQGGRGGRGGGRGRGGGRGGPR
FGGNTQRQAGGTQFTGGALGAAVRA
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgatttttccgcggcggcaacgagagctctagcgagagcagctccgacgaggag
gagctttactccgaagaggaggaggaagaactcgaagatgagggagatgactccgacaac
gacggttctggcgatgatgattccgactccgactccgacgccgacgctggcggcaagaag
aagggtgcggcaaagttcttggtggacgacgactcctcagatgaggaagacagcgatgca
gaggtgaccacaaaagtcaagagtgccaaggacaagcgcctcgatgagctcgagtctaca
gtgacggccatcgcaaatggcatgaagatcaacgactggggctctattgcgacagagttc
gacaagctcaaccgccaggctgagaagctgcgcactggtacaactgctcccaagatgtac
atcaagtctatcgcagatttggaagacttcatgaacgagactctggccaagcaaaaggtt
acccccaagaagatgaacgccacaaatgctcgcggtctgaacgccgtcaagcagcgcatc
aagaagaacaacaaggagtaccaggcacaaatcgatgcctacaaggccgacgagttcgag
tttatgatggacacagaggatgaggaggaaccggcaccaaagcccaagaaggcggccaag
gtctcctttgacgaggccactgcagaggacgaggaagatgacgagggcttcgcgagggtt
ggcaagggtggcaagaccctgcagttcacccccgagagcatcttcaagcacctgcggtca
attctggagtctcgtggtaagaagaacaccgatcgtggcgagcagatcaagatcatggaa
aagcttggcgagattgcccagacaccataccaacggattcgtgttctcctcgcactcgtc
tcttcacgcttcgatatcggtaccagcgcaggcgcggctctgtctgtcgagcactggaag
gctgcagagaaggagctgtctctcctgctgaccgtcctcgacgagaacaaggatcacatt
gttctggagagcgccgaggagtgggacgacgacgaaaagccccctaccctcgagaagggc
gaaaagtacatcaagatccctggaagcatcgtgtcctacacggaaaggcttgatgacgag
cttacccgctctctccaagccatcgaccctcacacctcagagtacatcgacaggctgagt
gacgagggtgctctgtacaacatcattttccgtgcccagctttactacgagggtcttcgc
aaggatgcctcgctcgagatccctcaggagagcttgaaccgtgccatcatgcgccgtctt
gatcacgtttacttcaagcccgctcaagtcatcaagattctcgaagagaacagctggaag
gctgttggtgacaaggcttccaacatcactccccgtgagcagacagtggaggccgcccaa
ctggtcaacgtcctttgcaactacctctttgccaacagcgagggcatccacagggcacga
gcgatgctgtgccagatctacttcttggctctgcacgatgactactacaagtctcgtgat
atgatgctcatgtctcacttgcaagagaccatcagcagcttcgacgtcctcacccagatt
ctttacaacaggacacttgtccaggttggtctctgtgccttccgcaagggtctggtttac
gatgctcagaacactctgcaagacatttgcggcagtggtaggcagaaagagctgctcgct
cagggtgtgatgatccagaggttcaaccaggtctcgccagagcaggagaggttagagagg
caaaggcagctgcccttccacatgcacatcaacttggagttgctggagtgtgtctacctc
acgtgcagcatgctgctcgagattcctctgctggcccagactggctcatcgcccgacatc
aagaagcgcatcatcagcaagacgtacaggcgcatgcttgagtaccacgagaggcaaatc
ttcactggacccccggagaacaccagggaccacgtgatgcaggcatccaaagcccttgcc
gctggcgagtggaagaaggccacgtccttcatccacagcatcaagatctgggagttgatg
cctaacgccgacgccatcaagaccatgcttgccaagcagatccaggaggagggtctgagg
acataccttttcacatacgctcccttctacgacacattgagcattgagacgctgagcaac
atgttcgagctcgagtcaaccaagatctcggccgttgtgagcaaaatgatcagccacgag
gagcttgccgctgccctcgaccaagtcaagcaaaccgtcatcttccgcaagggtgtcgag
ctcagccgtctgcagagccttgcccttaccctctcagacaaggccagctcgctcatcgag
tcaaacgagcgtacgttggagcagaggacccagggcacaagcaacgcgttcgagaggcag
ggcggcaggggtggccgcggcggtggccgaggcagaggcggcggcaggggaggcccgcgg
tttggcggcaacacacagcggcaagctggtggcacgcagttcaccggtggagcgctgggt
gcggctgtacgtgcgtag

DBGET integrated database retrieval system