KEGG   Mycobacterium grossiae: FZ046_24550
Entry
FZ046_24550       CDS       T06593                                 

Definition
(GenBank) mycofactocin-coupled SDR family oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mgro  Mycobacterium grossiae
Pathway
mgro00903  Limonene and pinene degradation
mgro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgro00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FZ046_24550
Enzymes [BR:mgro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     FZ046_24550
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: QEM47512
Position
5128603..5129439
AA seq 278 aa
MAGRLEGKVAFITGAARGQGRAHAVRMAQEGADIIAVDICKQIDSVLIPLANPEDLAETA
DMVKNLDRRIYTAEVDTRDFDALKAAVDAGVEEFGRLDVIVANAGIGNGGQTLDKTSEPD
WDDMIAVNLSGVWKTVKAGVPHIIEGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGL
MRTFAVELGAQNIRVNSVHPTNVNTPLFMNEPTMKLFRPDLENPGPEDIKVIGQMMHTLP
IGWVEPEDIANAVLFLASDEARYITGVTLPVDGGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcagggcggttagagggcaaggtcgcgttcatcaccggagccgcgcgcgggcagggc
cgtgcccacgccgtgcgcatggcccaggagggcgcggacatcatcgccgtcgacatctgc
aagcagatcgacagcgtgctcatccccctcgcgaatcccgaggatctcgccgagaccgcc
gacatggtgaagaacctcgaccggcggatctacaccgcggaggtcgacacccgggacttc
gacgcgctgaaggccgccgtcgacgccggcgtcgaggagttcggacggctcgacgtcatc
gtcgccaatgccggcatcggcaacggcggccagacgctcgacaagaccagtgagcccgac
tgggacgacatgatcgccgtcaacctctccggtgtgtggaagaccgtcaaggccggtgtc
ccgcacatcatcgagggcggccgcggcggctcgatcatcctcaccagctcggtcggcggc
ctcaaggcctacccgcacaccggccattacgtcgccgccaagcacggcgtcgtcggcctg
atgcgcaccttcgccgtcgaactgggcgcgcagaacatccgggtcaactccgtacacccg
accaacgtcaacacgccgctgttcatgaacgagccgacgatgaagctgttccgcccggac
ctggagaacccgggcccggaggacatcaaggtcatcggacagatgatgcacaccttgccg
atcggctgggtcgaacccgaggacatcgccaacgccgtgctgttccttgcctccgacgag
gcgcggtacatcaccggcgtcaccctgccggtcgacggcggcagctgcctgaagtag

DBGET integrated database retrieval system