KEGG   Magnetospirillum gryphiswaldense MSR-1: MSR1_30940Help
Entry
MSR1_30940        CDS       T05662                                 

Gene name
strE
Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mgry  Magnetospirillum gryphiswaldense MSR-1
Pathway
mgry00520  Amino sugar and nucleotide sugar metabolism
mgry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MSR1_30940 (strE)
Enzymes [BR:mgry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     MSR1_30940 (strE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AVM75560
Position
3268869..3269930
Genome map
AA seq 353 aa AA seqDB search
MTEFLLQSDIAEICQRLGKSAHDFAGKTVLLTGGRGFLGRYFMEMFAHLNEHILEKPCRL
IAMDNLITAGKEGSEIPDFPNVTFIQHDVIEPVKLDEKVDYVIHAAGIASPYYYRAYPLE
TLEVAVRGTRNMLELATEHNARFVFFSSSEIYGDPDPKHVPTPESYRGNVSCQGPRACYD
ESKRVGETLCHIFHEKHGTKTNTIRPFNVFGPGMQETDYRVLPNFANRIKAGRPLNVYGS
GNQTRTFCYITDAMVGFTLVVLKGVPGEPYNIGNPKPEISMVELVKSIEKAQGKKVEYNV
IEYPDSYPADEPNRRCPDIKKARLQLGFEPNVDLQDGLKRFLTWADKVYTGQE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatttctgctgcaatccgacatcgccgagatctgccaacggctgggcaaatcc
gctcacgatttcgccggcaagaccgtgctgttgaccggtggccgtggtttcctgggccgc
tatttcatggaaatgttcgcccatctgaacgaacacatcctggaaaagccgtgccgcctg
atcgccatggacaatctgatcactgccggcaaggaaggatcggaaatccccgattttccc
aacgtcactttcatccagcacgatgtgatcgagccggtgaagctggacgagaaggtggat
tacgtcatccacgccgccggtatcgccagcccgtattattaccgcgcctatccactggag
accctggaagtggcggtgcgcggcacccgcaacatgctggaactggccaccgagcataac
gcccgcttcgtcttcttctcgtcgtcggaaatctatggcgatcccgaccccaagcacgtg
ccgacgccggaaagctatcgcggcaacgtgtcgtgccagggtccgcgcgcctgctatgac
gaatcgaagcgggtgggtgaaaccctgtgccacatcttccatgaaaagcacggcaccaag
accaacaccatccgtccgttcaacgtcttcggccccggcatgcaggaaaccgattaccgg
gtgctgcccaatttcgccaaccgcatcaaggcgggccgtccgctcaacgtctatggctcg
ggcaaccagacccggaccttctgctacatcaccgacgccatggtcggctttaccctggtg
gtgctgaagggcgtgccgggcgagccctataatatcggcaatcctaagccggaaatctcc
atggtcgagctggtcaagagcatcgagaaggcccagggtaagaaggtcgaatacaacgtc
atcgaatacccggattcctatcccgccgatgaacccaatcgccgctgccccgacatcaag
aaggcccgtctgcaactgggcttcgaacccaatgttgatctgcaagacggcctcaagcgg
tttctgacctgggctgacaaggtctataccggtcaggagtaa

DBGET integrated database retrieval system