KEGG   Magnetospirillum gryphiswaldense MSR-1: MSR1_32580Help
Entry
MSR1_32580        CDS       T05662                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mgry  Magnetospirillum gryphiswaldense MSR-1
Pathway
mgry00520  Amino sugar and nucleotide sugar metabolism
mgry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MSR1_32580
Enzymes [BR:mgry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     MSR1_32580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD adh_short KR
Motif
Other DBs
NCBI-ProteinID: AVM75723
Position
complement(3446394..3447344)
Genome map
AA seq 316 aa AA seqDB search
MKYARKRVLVTGGAGFLGSHLCERLLADGHDVLCVDNFYTGSKDNIAHLIGNPYFELIRH
DVTFPLYLEVDEIFNLACPASPVHYQRDPVQTTKTSVHGAINMLGLAKRINAKIFQASTS
EVYGDPEVHPQTEDYRGSVNPIGPRACYDEGKRCAETLFFDYHRQHGLRIKVARIFNTYG
PRMHPDDGRVVSNFIVQALEGRPITLYGDGSQTRSFCFVDDLIEGFIRLMNSADDITGPI
NLGNPQEMTIRELAEAVIKLTGAKSELVIKPLPADDPLQRQPNIAKAREKLGWEPKVALE
DGLHRTIDYFRARLNA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgcacgcaagcgggttctggtgacgggtggcgcgggcttcctggggtcgcat
ctgtgcgaacgcctgctggccgatggtcacgatgtgctgtgcgtcgacaatttctatacc
ggcagcaaggacaacatcgcccatctaatcggcaacccttatttcgagctgatccgccac
gacgtcacctttccgctttatctggaagtggacgaaatcttcaacctggcctgcccggcc
agcccggtgcattaccagcgcgacccggtgcagaccaccaagacctcggtccacggcgcc
atcaacatgctgggcctagccaagcgcatcaatgccaagattttccaggcctccacctcg
gaggtctatggcgacccggaagtccatccgcagaccgaggattatcgcggttcggtcaac
cccatcggcccgcgcgcctgttatgacgagggcaagcgctgcgccgaaaccctgttcttc
gattatcaccgccagcatggcttgcgcatcaaggtcgcccgcatcttcaacacctatggt
ccgcgcatgcatcccgacgacggtcgggtggtgtccaacttcatcgtccaggcgctggaa
ggccggcccatcaccctttatggcgacggcagccagacccgatcgttctgcttcgtcgac
gacctgatcgagggtttcatccgcctgatgaacagcgccgacgacatcaccggccccatc
aacctgggcaacccgcaggaaatgaccatccgcgaactggccgaggcggtgatcaagctg
accggagccaaatccgaactggtaatcaagcccttgcccgccgacgatccgttgcaacgc
cagcccaacatcgccaaggcccgggaaaaattgggctgggaacccaaggtggcgctggag
gacggcctacaccgcaccatcgattatttccgcgcccgtttgaacgcctaa

DBGET integrated database retrieval system