KEGG   Mycoplasma gallisepticum NY01_2001.047-5-1P: HFMG01NYA_1176Help
Entry
HFMG01NYA_1176    CDS       T02202                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mgt  Mycoplasma gallisepticum NY01_2001.047-5-1P
Pathway
mgt00450  Selenocompound metabolism
mgt00970  Aminoacyl-tRNA biosynthesis
mgt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HFMG01NYA_1176 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HFMG01NYA_1176 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgt01007]
    HFMG01NYA_1176 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mgt03016]
    HFMG01NYA_1176 (metG)
Enzymes [BR:mgt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HFMG01NYA_1176 (metG)
Amino acid related enzymes [BR:mgt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HFMG01NYA_1176 (metG)
Transfer RNA biogenesis [BR:mgt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HFMG01NYA_1176 (metG)
 Prokaryotic type
   Other AARSs
    HFMG01NYA_1176 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF179 tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: AFP78689
Position
complement(197403..198077)
Genome map
AA seq 224 aa AA seqDB search
MSLSEDGKRLIQETINSDLINNLGNLVHRLIPMLESRQESTILPYLAGNEVEDKYLADLQ
KLPAEFEKLVEENDIRSAIKLVLNISKEYSSVIEVRKPWELYKNNKTQELANVLFAGTCA
IRTVFVLLEPILTTKSKEVYEQMNFTPEQTQLKNINNFEQLLNHKINKSKKLFQKLDVTD
PNVNLKPLEQQETKTKEVKDKKAKESSKQSPKEPTKEQAKEPTK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttaagtgaagatggtaaacgcttaatccaagaaacgattaactctgatctaatt
aataatctgggtaatttagttcacagattaattccgatgcttgaatcaagacaagaatct
acgatcttaccttatcttgcgggtaatgaagtagaagataaatatttagctgatctacaa
aaattaccggctgaatttgagaaactagttgaagaaaacgacattcgttctgcgattaaa
ttagtgcttaatatttcaaaagaatattcaagcgttattgaagtaagaaaaccttgagaa
ctttataaaaataacaaaactcaagaattggctaacgttttgtttgctggtacttgtgcg
attagaactgtttttgttcttcttgaaccaatcttaacgactaaatcaaaagaagtttat
gaacagatgaatttcacaccagaacaaacacaattaaaaaacattaataattttgaacaa
ctgttgaatcataagattaataagtcaaaaaaattgttccaaaaacttgatgtgaccgat
ccaaacgttaatctaaaacctctagaacaacaagaaacaaaaacaaaagaggttaaagat
aaaaaagctaaggaatcatctaaacaatcaccaaaagaacccactaaggaacaagcaaaa
gaaccaactaaataa

DBGET integrated database retrieval system