KEGG   Mycoplasma genitalium M2288: CM5_00095Help
Entry
CM5_00095         CDS       T02208                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
mgu00450  Selenocompound metabolism
mgu00970  Aminoacyl-tRNA biosynthesis
mgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CM5_00095
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CM5_00095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgu01007]
    CM5_00095
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mgu03016]
    CM5_00095
Enzymes [BR:mgu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CM5_00095
Amino acid related enzymes [BR:mgu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CM5_00095
Transfer RNA biogenesis [BR:mgu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CM5_00095
 Prokaryotic type
   Other AARSs
    CM5_00095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 VraX
Motif
Other DBs
NCBI-ProteinID: AFQ04322
Position
24468..26006
Genome map
AA seq 512 aa AA seqDB search
MKRCYITTPIYYASGKPHIGHAFTTILADVIKRFKIQNGYEAFLLVGSDEHGNKIESKAK
SLNLDPKTFVDINAQAFKLMWKTLNISFDHFIRTTDEIHKQQVQKTFQDLYDKKLIYQSE
WKGAYCVECEQNYFTFNKQTMLCEIGHNLSLVKEPCWFISFSSTKNWIETMIGKNQLNIV
PKSRASELKNNFINNGLNDLALTRKNVTWGIKVPFDPNQTIYVWFDALFSYITNLGFRNG
DPNFIKWWNNDNKEREVIHLISREITRFHCIYWPIFLHLLDIKLPTQFLSHGWIVDGEGR
KMSKSLNNVISPEQLIDQFGVDGTRYCLLKEMRLDKDNRCSISILKEIYNADLANSFGNH
VSRTFGMIKKYLNGKLEYQIITDNALQKIMILIDESIVKFDHYFNSYEFYRAINLLLKIV
FELSKLIDDFKPWELFKNQEFSLLKQLLFTCVRCVQVCYVLLTPILVNTASKVFHLFNFA
DDACRKDQLRDATLLKKIIISNSMEVLFKRVD
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttgttatattacaacccctatctactacgcatcaggtaagccccatataggt
catgcttttaccactattttggcggatgtaattaagcgttttaaaatccaaaacggatat
gaggcttttttgcttgttggcagtgatgaacatggcaataaaatagaaagtaaagctaaa
agcttaaatttagatcctaaaacatttgttgatattaacgctcaagcttttaagttaatg
tgaaagacccttaatattagttttgatcactttattagaacaactgatgaaatccataaa
caacaagttcaaaaaacatttcaagatttatatgacaaaaaactaatttatcaaagtgaa
tgaaaaggggcatattgtgttgagtgtgaacaaaattactttacttttaacaaacaaaca
atgttatgtgaaataggtcataatctcagtcttgttaaagaaccttgttgatttatttct
ttttcttctactaaaaattgaattgaaacaatgataggcaaaaatcaacttaacattgtt
cctaaatcacgtgcttctgaattaaaaaataactttataaacaatggtttaaacgattta
gcattaacaagaaaaaatgttacttgaggaataaaagttccttttgatccaaatcaaaca
atctatgtttggtttgatgcattgttttcttatatcaccaatttaggatttagaaatggt
gatcctaattttataaagtggtgaaataatgacaataaagaaagagaagttatccatctt
atatcacgtgaaatcaccagatttcactgcatctattgaccgatttttctacacttactt
gatattaagttaccaacccaatttttatcacatggctggatagttgatggtgaagggaga
aagatgtcaaaatctttaaacaacgttatctctccagaacaattaattgatcaatttggt
gttgatggtacaagatattgtttattaaaagagatgcgtttagataaagataatcgttgt
agtattagcatcttaaaagagatttataatgctgatcttgccaatagttttggaaaccat
gtttcacgtacttttggcatgattaaaaagtatctaaacggcaaattagaataccaaatt
attactgataatgcacttcaaaaaataatgattttaatagatgaatcaatcgttaaattt
gatcattactttaacagttatgaattttatagagcgattaatctacttttaaaaattgtt
tttgaattaagtaaattaattgatgatttcaaaccatgagaattgtttaaaaatcaggaa
ttctcacttttaaaacaactactttttacttgtgttaggtgtgtgcaggtatgctatgtg
ttgttaacacctatcttagtaaatactgcttcaaaagtttttcatttatttaatttcgct
gatgatgcctgtagaaaagaccaattaagagatgcaactttattaaaaaaaattattatc
tctaattcaatggaagttttatttaaaagagtagattaa

DBGET integrated database retrieval system