KEGG   Mycoplasma genitalium M2288: CM5_01255Help
Entry
CM5_01255         CDS       T02208                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
mgu00010  Glycolysis / Gluconeogenesis
mgu00030  Pentose phosphate pathway
mgu00051  Fructose and mannose metabolism
mgu00052  Galactose metabolism
mgu00680  Methane metabolism
mgu01100  Metabolic pathways
mgu01110  Biosynthesis of secondary metabolites
mgu01120  Microbial metabolism in diverse environments
mgu01130  Biosynthesis of antibiotics
mgu01200  Carbon metabolism
mgu01230  Biosynthesis of amino acids
mgu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM5_01255
   00030 Pentose phosphate pathway
    CM5_01255
   00051 Fructose and mannose metabolism
    CM5_01255
   00052 Galactose metabolism
    CM5_01255
  Energy metabolism
   00680 Methane metabolism
    CM5_01255
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CM5_01255
Enzymes [BR:mgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CM5_01255
Protein phosphatases and associated proteins [BR:mgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CM5_01255
Messenger RNA biogenesis [BR:mgu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CM5_01255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFQ04537
Position
254460..255431
Genome map
AA seq 323 aa AA seqDB search
MDKIAILTSGGDASGMNATIAYLTKYAIAKQLEVFYVKNGYYGLYHNHFITSKELDLTDF
FFMGGTVIGSSRFKQFQDPSLRKQAVLNLKKRGINNLVVIGGDGSYMGAKALSELGLNCF
CLPGTIDNDVNSSEFTIGFWTALEAIRVNVEAIYHTTKSHNRLAIIEVMGRDCSDLTIFG
GLATNASFVVTSKNSLDLNGFEKAVRKVLQFQNYCVVLVSENIYGKNGLPSLEMVKEHFE
NNAIKCNLVSLGHTQRGFSPNSIELFQISLMAKHTIDLVVNNANSQVIGMKNNQAVNYDF
NTAFNLPKADRTKLLNQVNTAII
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatagctattttaacttcgggtggtgatgctagtgggatgaatgccaccatc
gcttatctaaccaaatatgcaattgcaaagcaattggaagttttttatgtaaaaaacggt
tattatggcttgtatcacaaccattttatcaccagtaaggaacttgatttaactgacttt
ttctttatggggggaacagtaataggatcaagtcgtttcaaacagtttcaagatcctagc
ttacgaaaacaagcagttttaaacctcaaaaaacgtggtattaacaaccttgttgttatt
ggtggggatgggagttatatgggtgctaaagcactcagtgaattaggattaaactgcttt
tgtttacctggtacgatcgacaatgatgtcaattccagtgaatttaccattggtttttga
actgctttagaagcaattcgggttaatgttgaagcaatttatcacaccaccaaatcccat
aaccgcttagcaatcatagaagtgatggggcgtgattgtagtgatctgaccatctttggg
gggttagctactaatgctagttttgttgttactagcaaaaatagcttggatctcaatggc
tttgaaaaagcagtgagaaaggtgttgcaattccagaactattgtgttgttttggttagt
gaaaacatctatggtaagaacggtttacctagtttagaaatggttaaagagcactttgaa
aacaacgcaattaagtgtaacctagtttcactaggacacacccaaaggggctttagtcct
aatagtatcgaactctttcagattagtttaatggctaaacacacgattgatctggttgta
aataatgccaacagtcaagtaatagggatgaaaaacaaccaagcagttaactatgatttt
aacactgcttttaatttaccaaaagctgatagaaccaagttacttaaccaagttaacact
gcaattatttaa

DBGET integrated database retrieval system