KEGG   Mycoplasma genitalium M2288: CM5_02500Help
Entry
CM5_02500         CDS       T02208                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
mgu00010  Glycolysis / Gluconeogenesis
mgu00051  Fructose and mannose metabolism
mgu01100  Metabolic pathways
mgu01110  Biosynthesis of secondary metabolites
mgu01120  Microbial metabolism in diverse environments
mgu01130  Biosynthesis of antibiotics
mgu01200  Carbon metabolism
mgu01230  Biosynthesis of amino acids
Module
mgu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM5_02500
   00051 Fructose and mannose metabolism
    CM5_02500
   00562 Inositol phosphate metabolism
    CM5_02500
Enzymes [BR:mgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CM5_02500
Exosome [BR:mgu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CM5_02500
  Exosomal proteins of bladder cancer cells
   CM5_02500
  Exosomal proteins of melanoma cells
   CM5_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFQ04768
Position
complement(537043..537777)
Genome map
AA seq 244 aa AA seqDB search
MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIAPVYVHLTEIKKIISDSLLLF
AQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYYNETSAVINQKLFACLKASMQ
VVLCIGETLGQEISFLKTDLTNCLNTIDKSLIKNLVIAYEPLWAIGTGKTATPEVANQTI
KTIREYINDLYDENVANNISILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMA
RVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaaggtatttaattggcaattggaaaacaaataaaaatttaaaagacgcagtt
agttttgttgaacaatttcaacaaaataaacttaattacaatgccaaaattgggatagca
cctgtttatgttcatctcactgaaataaaaaaaataattagtgatagtctccttttattt
gcccaagacgctaactttattgaaagtggttcatatactggaactgtaagctttactcaa
cttcaagacattggtgttaacaacagtattattggtcattctgaaagaagaaaatactat
aacgaaaccagtgcagttattaatcaaaagctctttgcttgtctaaaagcatccatgcaa
gtagttttatgtattggtgagactttaggacaagagattagctttcttaaaactgatctt
actaattgcttaaatacgattgacaaaagcttaattaaaaatttagttattgcttatgaa
cctttgtgagcaattgggacaggtaaaacagcaactcctgaagttgcaaatcaaaccatt
aaaaccattagggaatatattaatgacttatatgatgaaaatgttgctaacaatatctca
attctatatggcggatcagttgatcataataatatccaaaaactagcaataatggaacaa
attgatggatttttagttggtaaagcatctttagaaattaaaaactttttagaaatggct
agggtatatgcataa

DBGET integrated database retrieval system