KEGG   Magnetospirillum gryphiswaldense: MGMSRv2__0194Help
Entry
MGMSRv2__0194     CDS       T02960                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mgy  Magnetospirillum gryphiswaldense
Pathway
mgy00640  Propanoate metabolism
mgy00650  Butanoate metabolism
mgy00900  Terpenoid backbone biosynthesis
mgy01100  Metabolic pathways
mgy01110  Biosynthesis of secondary metabolites
mgy01120  Microbial metabolism in diverse environments
mgy01130  Biosynthesis of antibiotics
mgy01200  Carbon metabolism
mgy01212  Fatty acid metabolism
mgy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGMSRv2__0194 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    MGMSRv2__0194 (atoB)
   00640 Propanoate metabolism
    MGMSRv2__0194 (atoB)
   00650 Butanoate metabolism
    MGMSRv2__0194 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MGMSRv2__0194 (atoB)
   00072 Synthesis and degradation of ketone bodies
    MGMSRv2__0194 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGMSRv2__0194 (atoB)
   00310 Lysine degradation
    MGMSRv2__0194 (atoB)
   00380 Tryptophan metabolism
    MGMSRv2__0194 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGMSRv2__0194 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGMSRv2__0194 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGMSRv2__0194 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgy04147]
    MGMSRv2__0194 (atoB)
Enzymes [BR:mgy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGMSRv2__0194 (atoB)
Exosome [BR:mgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGMSRv2__0194 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDK97409
UniProt: V6EW46
Position
complement(229242..230420)
Genome map
AA seq 392 aa AA seqDB search
MTTDPIVIVGSARTPMGGFQGELSGLTASQLGAHAIKAALTRANVAADQVEEVIMGCVLP
AGQGQAPARQASRGAGIPDAAGATTINKMCGSGMKAAMFAHDMLIAGTNRVMVAGGMESM
TNAPYLLDKARGGYRMGHGRVMDHMFLDGLEDAYDKGRLMGTFAEECAQSYQFTREAQDN
FALASLERACKAENLAAEIAPLTIKTRKGETVLAEDEQPRKAQPDKIPGLKPAFREGGTV
TAANSSSISDGGAALVMMRLSEAEKRGLTPLAAIRGHATYAHAPNLFTTAPVFAMRNLLD
KLAWKTGDVDLYEVNEAFAVVTMAAMRDLDLPHDKVNIHGGACALGHPIGASGARIIVTL
LAALQKYDLKRGVASLCIGGGEATALAVERLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgatcctatcgtcatcgtcggttccgcccgcacccccatgggcggttttcag
ggtgaattgtcgggcctgaccgccagccaattgggcgcccacgccatcaaggcggcgctc
acccgcgccaatgtcgccgccgatcaggtggaagaggtgatcatgggctgcgtcctgccc
gccggccagggccaggccccggcccggcaggcgtcgcgcggcgccggcattcccgatgcg
gcaggggcgaccaccatcaacaagatgtgcgggtcgggcatgaaggcggccatgttcgcc
cacgacatgctgatcgccggcaccaaccgtgtgatggtggccggcggcatggaaagcatg
accaacgccccttacctgctggacaaggcccgcggcggctatcgcatgggccatggccgg
gtgatggaccacatgttcctcgacgggctggaagacgcctatgacaagggccggctgatg
ggcaccttcgccgaggaatgcgcccaaagctatcagttcacccgcgaggcccaggacaat
ttcgccctcgcctcgctggaacgcgcctgcaaagcggaaaatctggcggccgagatcgcg
cccttgaccatcaagacccgcaagggcgaaaccgtgctggccgaggacgagcagccgcgc
aaggcccagcccgacaagatccccggcctcaaacccgctttccgcgaaggcggcacggtg
acggcggccaattcgtcgtccatttccgatggcggcgccgccctggtgatgatgcggctg
tcggaggcggaaaagcgcggcctgacgcccttggccgccattcgcggccatgccacctat
gcccacgcccccaatcttttcaccaccgccccggtcttcgccatgcgcaacctgctggac
aagctggcgtggaagaccggcgacgtcgatctgtacgaagtcaacgaagccttcgccgtg
gtcaccatggcggccatgcgcgatctggatttgccgcacgacaaggtcaatatccatggc
ggcgcctgcgcactgggtcaccccatcggcgcctcgggggccaggatcatcgtcaccttg
ctggcggcgttgcagaaatacgacctgaagcgcggtgtcgccagcttgtgcatcggcggc
ggtgaagccaccgccctggcggtggagcggctggcatga

DBGET integrated database retrieval system