KEGG   Magnetospirillum gryphiswaldense: MGMSRv2__1838Help
Entry
MGMSRv2__1838     CDS       T02960                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase containing thiolase domain (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mgy  Magnetospirillum gryphiswaldense
Pathway
mgy00071  Fatty acid degradation
mgy00072  Synthesis and degradation of ketone bodies
mgy00280  Valine, leucine and isoleucine degradation
mgy00310  Lysine degradation
mgy00362  Benzoate degradation
mgy00380  Tryptophan metabolism
mgy00620  Pyruvate metabolism
mgy00630  Glyoxylate and dicarboxylate metabolism
mgy00640  Propanoate metabolism
mgy00650  Butanoate metabolism
mgy00900  Terpenoid backbone biosynthesis
mgy01100  Metabolic pathways
mgy01110  Biosynthesis of secondary metabolites
mgy01120  Microbial metabolism in diverse environments
mgy01130  Biosynthesis of antibiotics
mgy01200  Carbon metabolism
mgy01212  Fatty acid metabolism
mgy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGMSRv2__1838 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    MGMSRv2__1838 (phbA)
   00640 Propanoate metabolism
    MGMSRv2__1838 (phbA)
   00650 Butanoate metabolism
    MGMSRv2__1838 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MGMSRv2__1838 (phbA)
   00072 Synthesis and degradation of ketone bodies
    MGMSRv2__1838 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGMSRv2__1838 (phbA)
   00310 Lysine degradation
    MGMSRv2__1838 (phbA)
   00380 Tryptophan metabolism
    MGMSRv2__1838 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGMSRv2__1838 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGMSRv2__1838 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGMSRv2__1838 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgy04147]
    MGMSRv2__1838 (phbA)
Enzymes [BR:mgy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGMSRv2__1838 (phbA)
Exosome [BR:mgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGMSRv2__1838 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDK99053
UniProt: V6F3J9
Position
complement(1937093..1938265)
Genome map
AA seq 390 aa AA seqDB search
MTDIVIVSAARTPVGSFSGSLSGYQAAQLGEIVIREVLSRANVAADDVSEVLMGHILSAG
NGMNTARQAALKAGLPIGSTAMTINQVCGSGLRAVALGMQAILAGDSKVVVAGGHESMSN
SQHAGYLRSGIKMGPMGFVDTMINDGLTDVFNAYHMGVTAENVAKEYGITREEQDEFAVA
SQNKAEAAVKSGRFKDEIVPVKIVVKKEEKLFDTDEYIRSGATVEAMAKLKPAFDKAGTV
TAGNASGINDGAAAVLLMTAEEAAKRGLKPLATIKSWATAGVDPKVMGIGPVPASKLALE
KAGWTHEQLDLIEANEAFASQAIAVNKGMGWDTSKVNVNGGAIAIGHPIGASGCRVLVSL
IHEMIKRDAKKGLATLCIGGGMGIAMCIER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgttatcgtttccgccgcccgtacccccgtgggctcgttcagcggttcc
ctttccggctatcaggctgcgcagctgggcgagatcgtcatccgcgaagtcctgtcccgc
gccaatgtcgccgccgacgacgtgtcggaagtgctgatgggacacatcctgtccgccggc
aacggcatgaacaccgcccgtcaggcggcgttgaaggccggcctgcccatcggttccacc
gccatgaccatcaatcaggtctgcggttccggcctgcgcgccgtcgccttgggcatgcag
gccatcctggccggcgattccaaggtggtggtggccggcggccatgaaagcatgagcaac
tcgcagcacgccggatacttgcgcagcggcatcaagatggggccgatgggcttcgtcgat
accatgatcaatgacggtctgaccgacgtgttcaacgcctatcacatgggcgtcaccgcc
gagaacgtggccaaggaatacggtatcacccgcgaagagcaggacgaattcgccgtcgct
tcccagaacaaggccgaagccgccgtcaagtcgggccgtttcaaggacgaaatcgtcccg
gtcaagatcgtggtgaagaaggaagaaaagctgttcgacaccgacgaatacatccgttcg
ggcgccaccgtcgaagccatggccaagctgaagcccgccttcgacaaggccggcaccgtc
accgccggcaatgcctcgggcatcaatgacggcgcggcggcggtgctgctgatgaccgcc
gaagaagcggccaagcgcggtctcaagcccttggccacgatcaagagctgggctaccgcc
ggtgtcgaccccaaggtcatgggcatcggcccggtgccggcgtccaagctggccctggaa
aaggccggctggacccatgaacagctcgacctgatcgaagccaacgaagccttcgcctcc
caggccatcgccgtcaacaagggcatgggctgggataccagcaaggtcaacgtcaatggc
ggcgccatcgccatcggtcaccccatcggcgcctcgggctgccgcgtcctggtgtcgttg
atccatgaaatgatcaagcgcgacgccaagaagggcctggccaccttgtgcatcggtggc
ggcatgggcatcgccatgtgcatcgagcggtaa

DBGET integrated database retrieval system