KEGG   Mycoplasma gallisepticum S6: GCW_03875Help
Entry
GCW_03875         CDS       T02953                                 

Definition
(GenBank) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mgz  Mycoplasma gallisepticum S6
Pathway
mgz00010  Glycolysis / Gluconeogenesis
mgz00280  Valine, leucine and isoleucine degradation
mgz00310  Lysine degradation
mgz00330  Arginine and proline metabolism
mgz00380  Tryptophan metabolism
mgz00561  Glycerolipid metabolism
mgz00620  Pyruvate metabolism
mgz00625  Chloroalkane and chloroalkene degradation
mgz01100  Metabolic pathways
mgz01110  Biosynthesis of secondary metabolites
mgz01120  Microbial metabolism in diverse environments
mgz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mgz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GCW_03875
   00053 Ascorbate and aldarate metabolism
    GCW_03875
   00620 Pyruvate metabolism
    GCW_03875
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GCW_03875
   00561 Glycerolipid metabolism
    GCW_03875
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GCW_03875
   00310 Lysine degradation
    GCW_03875
   00330 Arginine and proline metabolism
    GCW_03875
   00340 Histidine metabolism
    GCW_03875
   00380 Tryptophan metabolism
    GCW_03875
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GCW_03875
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GCW_03875
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GCW_03875
Enzymes [BR:mgz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     GCW_03875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHC00032
UniProt: A0A0F6CLQ9
Position
935818..936114
Genome map
AA seq 98 aa AA seqDB search
MDNNKHSIEEMMALKYYHIFFTGNGNVAKKVMEKASADLTPVTLELGGKSPCIIDKDINL
EKTVKSFLFGKMLNAGQTCIAQIIWLFTKIYTILLLTN
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggataataataaacattctatcgaagaaatgatggcgttaaaatattatcacattttc
tttactggcaacggtaatgttgctaaaaaagttatggaaaaagcttcagctgatttgaca
ccagtaactttagaattaggtggcaaatccccatgtattattgataaagatatcaatcta
gaaaaaactgttaaaagttttttatttggaaagatgttaaacgctggtcaaacatgtatt
gcccagattatttggttgttcacaaagatatatacaattcttttattaacgaattaa

DBGET integrated database retrieval system