KEGG   Mycoplasma haemofelis Langford 1: HF1_00220Help
Entry
HF1_00220         CDS       T01418                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
mha  Mycoplasma haemofelis Langford 1
Pathway
mha00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mha00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HF1_00220 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mha01007]
    HF1_00220 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mha03016]
    HF1_00220 (cysS)
Enzymes [BR:mha01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     HF1_00220 (cysS)
Amino acid related enzymes [BR:mha01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   HF1_00220 (cysS)
Transfer RNA biogenesis [BR:mha03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HF1_00220 (cysS)
 Prokaryotic Type
    HF1_00220 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CBY92030
UniProt: E8ZGK0
Position
complement(21081..22355)
Genome map
AA seq 424 aa AA seqDB search
MSLKLYDSLEQTLKTLPKDPKIYLCGPTVYDYVHIGNVAPLIIFDFLIRYLEYKRENYLY
IHNITDIDDKIVNKAKELSLKEEEIASEYTDHYLWVMNALNVIKPTLMPKVSDHIEDIQR
DVSSLLESGFAHFEGKDVVMNIGKIKNYGCLSKQNLNMLKSNENFCLWKYMENGKTWKSP
WGDGRPGWHSECFSFINRYSRGGVDLHGGGIDLKFPHHENENAHSEALYSKSLSKIWMYI
GHLQTQDGKISKSTNKKFLVKDLLEKYSANSLRYLFLTSKYSLPLLVDESRIEEVGKEFD
NYLLTINQAKTYLYLNGGEINSAGDLDSEFLSIFENDLNLPEVLTWLQKLKKEVLTGIKE
KKIEVVSKGGSQLIRHLEFLGFKIEDEHTVENVALIDEWKNSLANKDYSKADEIRELLKR
RRIL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcttaagctttacgactccctagaacagactctcaagactttacctaaggatccc
aagatatatctttgtggccctactgtttacgattacgtacacatagggaatgtagctcca
cttataatctttgatttcttaattcgatatctagagtataaaagggagaattacctttac
atacataacatcacagacatagacgataagatagtcaataaagctaaagaattaagtctt
aaagaggaggagattgcttctgaatacacagatcactatctgtgagtaatgaatgcacta
aatgtaattaagcctaccttgatgccaaaggtaagtgatcacattgaagatattcaaaga
gatgtatcttctctattggaatccggattcgcccacttcgaaggcaaggatgtcgttatg
aatatagggaagataaagaattatggatgtttgtcaaaacaaaatttgaacatgcttaag
tccaatgaaaacttttgcctttggaaatatatggagaatggaaagacatggaagagtcct
tggggagatggaagacctggatgacatagtgaatgcttctcttttataaatagatactca
agagggggggtggatttacatggaggggggatagatcttaagtttcctcatcacgagaat
gaaaatgcccactctgaagcactatattcaaagtccttatctaagatatgaatgtatatt
ggacatctacaaactcaggatgggaagatatccaaatctaccaataagaagtttttagtt
aaagatctcctcgagaagtactccgccaactccttgagatatttattcttaactagcaaa
tatagtcttcccctactcgtggatgaaagcagaattgaagaagtgggaaaggagtttgac
aattatctattgaccataaatcaagctaagacttatctctacttaaatgggggcgagatt
aattccgcgggcgatctggatagtgagttcttgagtatttttgagaatgatttaaatctc
cccgaagtactcacttgacttcaaaaattgaaaaaggaagttttgactggaatcaaggag
aagaagattgaagtggtttctaagggggggtctcaattaataagacatttggaatttctg
ggtttcaagatagaggatgagcatactgttgagaatgttgcattaatagatgagtgaaag
aattctctagccaataaggattattcaaaggcagatgaaattagggagcttcttaagaga
aggagaattctgtaa

DBGET integrated database retrieval system